BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0195 (669 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024807-2|AAF59528.2| 431|Caenorhabditis elegans Hypothetical ... 138 3e-33 >AC024807-2|AAF59528.2| 431|Caenorhabditis elegans Hypothetical protein Y53G8AL.2 protein. Length = 431 Score = 138 bits (334), Expect = 3e-33 Identities = 73/156 (46%), Positives = 98/156 (62%), Gaps = 1/156 (0%) Frame = +3 Query: 30 GRFKYNDVHVDGVRRIARICREEGVERFIHLSYLNAEEHPKPLVLKKPSAWKISKYLGEC 209 G++ Y DV+ G RR+ARIC+E GVE+F+HLS L A P+ S + SK LGE Sbjct: 143 GKYNYYDVNDTGARRLARICKEMGVEKFVHLSALGATTQPQKGHFVAKSQFLHSKGLGEV 202 Query: 210 AVREEYPTATIIRASDIYGSEDRFLRSLVNKMR-SHSNLMPLYKNGLATVKQPVFVSDVA 386 AVREE+P ATIIR S IYG D F++ V++ R + + + LYK G T K P++V DVA Sbjct: 203 AVREEFPEATIIRPSVIYGELDGFIQYYVSRWRKTPLDYVYLYKKGEETYKMPIWVGDVA 262 Query: 387 QGIVNAARDDDTKCEVYQAVGPKRYLLADLVDWFYK 494 GI +A D K Y+ VGP Y L++L+D+ YK Sbjct: 263 AGIQSAVNDPTAKGHTYEFVGPHCYQLSELIDFMYK 298 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,392,414 Number of Sequences: 27780 Number of extensions: 321091 Number of successful extensions: 772 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 770 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1508017654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -