BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0192 (517 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 39 0.059 UniRef50_Q4A2C8 Cluster: Putative uncharacterized protein; n=1; ... 33 5.1 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 39.1 bits (87), Expect = 0.059 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 151 HRHSPLSFSSDLLSGSRFRSGGRF 80 HR PLSFS DLLSGSRFR+G + Sbjct: 392 HRCCPLSFSPDLLSGSRFRTGAEY 415 >UniRef50_Q4A2C8 Cluster: Putative uncharacterized protein; n=1; Emiliania huxleyi virus 86|Rep: Putative uncharacterized protein - Emiliania huxleyi virus 86 Length = 194 Score = 32.7 bits (71), Expect = 5.1 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 336 LNRSLQYDRRNLASLNIAAGELSEPYRELPNLYDVKKRDVQYACLRMLFNRFF 494 L+++ Y R +IAA L E + +LPNL +K ++ Y + L +R F Sbjct: 133 LSQTFSYYRHANQDQHIAAYLLVETFEKLPNLLVIKTPNIAYKAIAKLVSRLF 185 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,930,771 Number of Sequences: 1657284 Number of extensions: 9475823 Number of successful extensions: 19651 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19635 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31782822356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -