BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0192 (517 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8329| Best HMM Match : FTR1 (HMM E-Value=0.87) 31 0.74 >SB_8329| Best HMM Match : FTR1 (HMM E-Value=0.87) Length = 371 Score = 30.7 bits (66), Expect = 0.74 Identities = 19/59 (32%), Positives = 30/59 (50%) Frame = -2 Query: 387 LYSDSPSYVGRIVMSDLVGNFILLILCHGARAS*NFTLINFS*RAXKKYNFKNIG*TPS 211 +YS PSY+ IV+ L ++IL I+ +G S T++ +S + G TPS Sbjct: 195 VYSLKPSYILTIVVYGLTPSYILTIIVYGLTPSYILTIVVYSLKPSYILTIVVYGLTPS 253 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -2 Query: 387 LYSDSPSYVGRIVMSDLVGNFILLILCHGARAS*NFTLI 271 +YS PSY+ IV+ L ++IL I+ +G S T+I Sbjct: 234 VYSLKPSYILTIVVYGLTPSYILTIVVYGLTPSYILTII 272 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,119,732 Number of Sequences: 59808 Number of extensions: 291750 Number of successful extensions: 502 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -