BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0192 (517 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 1.5 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 2.6 AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 24 3.5 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 24 3.5 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 4.6 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.0 bits (52), Expect = 1.5 Identities = 21/45 (46%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +3 Query: 369 LASLNIAAG--ELSEPYRELPNLYDVKKRD-VQYACLRMLFNRFF 494 L LN AG ELS P ELPN + V R VQY + F FF Sbjct: 416 LQPLNPHAGTVELSIPLIELPNAFGVSVRKYVQYK--NIPFESFF 458 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.2 bits (50), Expect = 2.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = +2 Query: 119 IRRETQWAVSMG*LARQDPILSTYHLFIYWRD 214 +RR T W + G L + Y ++WR+ Sbjct: 2644 VRRNTNWEAAAGLLKGVSEAIIRYPHILHWRE 2675 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 23.8 bits (49), Expect = 3.5 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 406 NRTENYRIYTMS 441 NRT NYR+ TMS Sbjct: 490 NRTANYRVVTMS 501 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 23.8 bits (49), Expect = 3.5 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 406 NRTENYRIYTMS 441 NRT NYR+ TMS Sbjct: 490 NRTANYRVVTMS 501 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.4 bits (48), Expect = 4.6 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -2 Query: 426 SVILGTVRKVPLRLYSDSPSYVGRIVMSDLVGNFILLILCHGAR 295 S+ L ++ +RLY+D P+ +SDL + +L R Sbjct: 415 SIELEECERIFVRLYADYPAECKEFGLSDLAAGVVAPLLASRLR 458 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 522,294 Number of Sequences: 2352 Number of extensions: 10583 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -