BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0191 (540 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC622.21 |wtf12||wtf element Wtf12|Schizosaccharomyces pombe|c... 26 3.1 SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosacch... 26 4.1 SPAC56F8.15 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 9.5 SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosacc... 25 9.5 >SPCC622.21 |wtf12||wtf element Wtf12|Schizosaccharomyces pombe|chr 3|||Manual Length = 197 Score = 26.2 bits (55), Expect = 3.1 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = +3 Query: 84 FIDYDIYILIVFLVFSVCEGSLGLSILVSIIRSHGN---DYFQRFRIL 218 F+ + LI+ + + G +G+SI+ +I +GN DYF R+L Sbjct: 122 FVLIGLTCLILLITMILEPGLIGISIMKRLIGDNGNDERDYFVENRLL 169 >SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2176 Score = 25.8 bits (54), Expect = 4.1 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +3 Query: 84 FIDYDIYILIVFLVFSVCEGSLGLSILVSIIRSHGNDYFQRF 209 +IDY I L+ L F+ GS LS ++ + + +Y+++F Sbjct: 1711 YIDYPISELLQMLGFTASIGSSELSQVILMTVTTKKEYYKKF 1752 >SPAC56F8.15 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 176 Score = 24.6 bits (51), Expect = 9.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 108 LIVFLVFSVCEGSLGLSILVSII 176 + FLVFS CE +G S+ +I Sbjct: 1 MFFFLVFSACEVFVGFSLCTLVI 23 >SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosaccharomyces pombe|chr 1|||Manual Length = 1318 Score = 24.6 bits (51), Expect = 9.5 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 217 YNDKIFIYNNFYNSFMFYKKYILIGSNNIIFY 312 Y + NN + + + KKY ++ S +IFY Sbjct: 1052 YKKMVLSKNNRWVAGYWKKKYCIVDSGKLIFY 1083 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 762,330 Number of Sequences: 5004 Number of extensions: 7255 Number of successful extensions: 21 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 221892220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -