BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0190 (688 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0284 + 21909758-21913645 33 0.28 01_06_0115 + 26585481-26586401,26586501-26586556,26586747-265868... 32 0.37 04_03_0786 - 19621674-19621960,19623152-19623193,19623679-19624339 31 0.65 03_05_0211 - 22020515-22020687,22020801-22020831,22022060-220221... 31 1.1 06_01_0996 + 7746358-7746493,7747102-7747262,7747586-7747647,774... 29 3.5 02_02_0346 - 9214365-9214583,9214830-9214919,9215012-9215177,921... 29 4.6 10_07_0044 + 12319382-12319532,12319978-12320163,12320247-123203... 28 6.0 03_05_0618 + 26177743-26178420,26179477-26179617 28 6.0 01_01_0284 - 2357085-2357244,2357354-2357730,2359114-2359371 28 6.0 11_06_0289 - 21969248-21973516 28 8.0 10_08_0959 - 21813756-21814097,21814462-21814570,21814688-218147... 28 8.0 07_03_0167 - 14649782-14649864,14649954-14650078,14650357-146504... 28 8.0 06_01_0983 - 7630651-7630683,7630717-7630942,7630993-7631234,763... 28 8.0 06_01_0878 + 6735266-6735340,6735946-6736041,6738610-6738720,673... 28 8.0 05_03_0373 - 13194723-13195847,13196219-13196809 28 8.0 03_05_0977 + 29355824-29357056 28 8.0 03_02_0721 - 10677286-10678018,10679293-10679373,10682516-106826... 28 8.0 02_04_0268 + 21435231-21435240,21435330-21435558,21435778-214358... 28 8.0 >11_06_0284 + 21909758-21913645 Length = 1295 Score = 32.7 bits (71), Expect = 0.28 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 318 DCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 413 D DY++ DYD+ + E + +++ D D+PI Sbjct: 520 DDDYDDDDYDDNEEEKKYDDDDDDDDDDDDPI 551 >01_06_0115 + 26585481-26586401,26586501-26586556,26586747-26586876, 26587396-26587506,26587606-26587674,26588125-26588198, 26588446-26588581,26588702-26588795,26588901-26589000, 26589100-26589224,26589597-26589634,26589662-26589742, 26589868-26589972,26590102-26590166,26590371-26590572, 26591073-26591159,26591238-26591294,26591369-26591458, 26591572-26591658,26592204-26592278,26592363-26592463, 26592565-26592655 Length = 964 Score = 32.3 bits (70), Expect = 0.37 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +3 Query: 240 KPYKYESQMAFMKAFYKDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSD 404 +PY Y + MK Y D D D D ++ D D+ D E+ +E++E + + Sbjct: 192 EPYSYYHRKGLMKRQYDD-----DDDDDDDDDDDDDDEDEEAEEEEEEEEEEEEE 241 >04_03_0786 - 19621674-19621960,19623152-19623193,19623679-19624339 Length = 329 Score = 31.5 bits (68), Expect = 0.65 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +3 Query: 138 LKRPAVDCKIRWINIRDVHRRL--WKKRLSDPNRSSKPYKYESQMAF 272 L+R V C+ RW N+ ++++ W++ LS P+ SS +++F Sbjct: 66 LERGPVQCRKRWSNLAGDYKKIREWERSLSSPSSSSAAAGMGKEVSF 112 >03_05_0211 - 22020515-22020687,22020801-22020831,22022060-22022169, 22022715-22023102,22023344-22023397,22023739-22023849, 22023956-22024015,22024618-22024694,22026155-22026188, 22026267-22027235 Length = 668 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 3/79 (3%) Frame = +3 Query: 177 NIRDVHRRLWKKRLSDPNRSSKPYKYESQMAFMKAFYKDVAIPL--DSGDCDYEEKDYDE 350 NIR +KR S P SSK + + + K K + D D D + D +E Sbjct: 414 NIRKGSNSRKRKRGSTPKSSSKKFDDDDDITPSKKRNKALEYDTDEDEDDADPMKSDSEE 473 Query: 351 WDNESGQEQ-QENNSDSSD 404 D +S +E+ ++N+SD+ D Sbjct: 474 DDYDSEKEKAKKNSSDAKD 492 >06_01_0996 + 7746358-7746493,7747102-7747262,7747586-7747647, 7748142-7748595,7748994-7749134,7749444-7749633, 7749842-7750530,7750605-7750804,7751210-7751375, 7751850-7752046,7752162-7752396 Length = 876 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 + GD D +E + +E DN+ G+E + + +D+ Sbjct: 408 EDGDSDDDEDEGEEDDNDEGEEDDDEDRSENDD 440 >02_02_0346 - 9214365-9214583,9214830-9214919,9215012-9215177, 9215601-9215911,9215944-9216566,9216779-9216968, 9217096-9217197,9217285-9217425,9217815-9218411, 9219126-9219286,9220709-9220824,9221538-9221654, 9221746-9221808,9221879-9221949 Length = 988 Score = 28.7 bits (61), Expect = 4.6 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 + GD D +E + DE D++ G+E + + +D+ Sbjct: 547 EDGDSDDDEDEGDEDDDDEGEEDDDEDRSENDD 579 >10_07_0044 + 12319382-12319532,12319978-12320163,12320247-12320396, 12320495-12320644,12320728-12321417,12321641-12322033, 12322073-12322546,12322634-12323974,12324042-12324388 Length = 1293 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/51 (33%), Positives = 22/51 (43%) Frame = +1 Query: 331 KRKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLR 483 ++K MN R N + I MN R+ R R +HL RRN R Sbjct: 331 EQKQEMNARLRVARQNLPDVDIHEMNARRRSRRQNVTPGERTAHLARRNAR 381 >03_05_0618 + 26177743-26178420,26179477-26179617 Length = 272 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 315 GDCDYEEKDYDEWDNESGQEQQENNSDSS 401 GD D EE+ +E D E G+E+ E+ D + Sbjct: 206 GDEDDEEEGDEEEDEEEGEEEAEDEEDEA 234 >01_01_0284 - 2357085-2357244,2357354-2357730,2359114-2359371 Length = 264 Score = 28.3 bits (60), Expect = 6.0 Identities = 29/117 (24%), Positives = 53/117 (45%), Gaps = 6/117 (5%) Frame = +3 Query: 81 PKYMDFNAREVTWQKIGDELKRPAVDCKIRWINIRDVHRRLWKKRLSDPNRSSKPYKYES 260 P+ M F++ T EL R +D +I++ D H R+ + + P + S + S Sbjct: 48 PRSMPFSSAPSTRPSSDGELLR-IIDAEIKFAEESDDHDRVEEIPDNFPFKISDEKGFNS 106 Query: 261 QMAFMKAFYKD-----VAIP-LDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 413 + + + + V++P L +GD E + DE NE QE++ + S P+ Sbjct: 107 -ITLTRTYQGENIEVLVSMPSLVTGDEPDRENEADEDRNEDDQEEETQKAPKSSIPL 162 >11_06_0289 - 21969248-21973516 Length = 1422 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +3 Query: 318 DCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 413 D D +E D+ D+E +E++E++ D +EPI Sbjct: 515 DADNDEDSNDDDDDE--EEEEEDDDDDEEEPI 544 >10_08_0959 - 21813756-21814097,21814462-21814570,21814688-21814740, 21814849-21815049,21815320-21815433,21815513-21815671, 21816490-21816849,21816928-21817149,21817967-21818093, 21818887-21819023,21819169-21819292,21819665-21820174, 21820255-21820436,21820812-21820862,21821114-21821266, 21821339-21821437,21821519-21821861,21821957-21822030, 21822105-21823025,21823133-21823257,21823419-21823461, 21823574-21823762,21824814-21825074,21825228-21825387, 21826200-21826363,21826523-21827009,21827090-21827431, 21827519-21827836,21828001-21828041,21828136-21828388, 21829158-21829261,21830198-21830386,21830543-21831196, 21831320-21831610,21831739-21831882,21832107-21832205, 21832549-21832657,21832739-21832923,21833008-21833121, 21833270-21833401,21833483-21833815,21833945-21834436, 21834773-21834847,21834917-21835066,21835143-21835241, 21835463-21835547,21837188-21837375,21837513-21837647, 21837729-21837849,21838127-21838194,21838275-21838370, 21838450-21838554,21838665-21838980,21839053-21839142, 21840011-21840181,21840850-21841010,21841088-21841270, 21841839-21841940,21842515-21842632,21842704-21842798, 21842972-21843022,21843107-21843241,21843333-21843436, 21844249-21844414,21844649-21844773,21845220-21845316 Length = 4181 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 24 DVTLISLVKQNPVLYDYNNPKYMDFNAREV 113 D+T S VK V+YD +P+Y + + R V Sbjct: 1149 DITFESFVKAQIVIYDQQSPQYNNLDNRVV 1178 >07_03_0167 - 14649782-14649864,14649954-14650078,14650357-14650400, 14650873-14651003,14652469-14652559,14653335-14653445, 14653623-14653774,14653863-14654067,14654436-14654764, 14654850-14655309 Length = 576 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +1 Query: 346 MNGTTNQGRSNKRTIVIPPMN-QSRKLRGGVNQKESRKSHLTRRNLRPPT 492 MN R N + I MN R R V E R +HLTRRN R T Sbjct: 1 MNARRRVARQNLLDVKIHDMNAHCRSRRQNVTPGE-RSTHLTRRNARYAT 49 >06_01_0983 - 7630651-7630683,7630717-7630942,7630993-7631234, 7631502-7631591,7631680-7631845,7632225-7633191, 7633402-7633591,7633908-7634048,7634416-7634736 Length = 791 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/34 (35%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQE-QQENNSDSSDE 407 + GD D +E + +E D++ G+E E+ S++ DE Sbjct: 245 EDGDSDDDEDEGEEDDDDEGEEDDDEDRSENDDE 278 >06_01_0878 + 6735266-6735340,6735946-6736041,6738610-6738720, 6738816-6739309,6739422-6739587,6739666-6739789, 6739874-6739986,6740085-6740693,6743095-6743385, 6743845-6743913,6744099-6744188,6744281-6744696, 6744882-6744969 Length = 913 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +3 Query: 324 DYEEKDYDEWDNESGQEQQ-ENNSDSSDE 407 D E+ D+D +S +EQ E+NSD SDE Sbjct: 484 DSEDGDFDPAGPDSDKEQNDESNSDQSDE 512 >05_03_0373 - 13194723-13195847,13196219-13196809 Length = 571 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 78 NPKYMDFNAREVTWQKIGDELKRPAVDCKIRWINIRDVHRRL 203 NPK++DF W +ELK + + + IN RD L Sbjct: 241 NPKFVDFFCENFDWAVFENELKWYSTEPQRGQINYRDADELL 282 >03_05_0977 + 29355824-29357056 Length = 410 Score = 27.9 bits (59), Expect = 8.0 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 3/72 (4%) Frame = +3 Query: 204 WKKRLSDPNRSSKPYKYESQ-MAFMKAFYKDVAIPLDSGDCDYEEKDYDEWDNESGQEQQ 380 ++K+ N + +K + Q ++ KD+ L++ +E+ DE + E QE + Sbjct: 41 YEKKAYHENEPNDLHKDDDQNQGEIRLGRKDLPTKLEADSSTLDERIEDEENEEMEQEMK 100 Query: 381 --ENNSDSSDEP 410 EN+ D DEP Sbjct: 101 HDENDEDPIDEP 112 >03_02_0721 - 10677286-10678018,10679293-10679373,10682516-10682645, 10682969-10683101 Length = 358 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +1 Query: 385 TIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP--TSAILAPLQNSTP 528 TI + + + K RGG +SRK R PP T+A PL S+P Sbjct: 159 TIDVTKLQAAGKRRGGRTAGQSRKGDKKRAEDDPPKETAAADTPLPESSP 208 >02_04_0268 + 21435231-21435240,21435330-21435558,21435778-21435898, 21435992-21436264 Length = 210 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +1 Query: 286 IKTLPSPWTVVTAITKRKT-MMNGTTNQGRSNKR 384 I LP+ + VVT I K++T + NG++ +SN + Sbjct: 87 INGLPTVYEVVTGIAKKQTKVSNGSSKSNKSNPK 120 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,146,544 Number of Sequences: 37544 Number of extensions: 299811 Number of successful extensions: 1061 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1058 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -