BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0190 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36653| Best HMM Match : ACBP (HMM E-Value=3.6) 33 0.16 SB_21719| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_25596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_15897| Best HMM Match : DUF134 (HMM E-Value=7.5) 33 0.22 SB_8672| Best HMM Match : PKD_channel (HMM E-Value=1.4e-38) 33 0.29 SB_21967| Best HMM Match : BAG (HMM E-Value=1.7e-18) 32 0.50 SB_34257| Best HMM Match : DUF1172 (HMM E-Value=1.3) 31 0.66 SB_52001| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_31911| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_34910| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_21591| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_59548| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_56851| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_44902| Best HMM Match : EGF (HMM E-Value=9.6e-06) 30 1.5 SB_1693| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_52916| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_29898| Best HMM Match : Chromadorea_ALT (HMM E-Value=0.0085) 30 1.5 SB_27218| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.42) 30 1.5 SB_26379| Best HMM Match : HALZ (HMM E-Value=1.4) 30 1.5 SB_25550| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_20735| Best HMM Match : HALZ (HMM E-Value=4.6) 30 1.5 SB_37031| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_48579| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_43512| Best HMM Match : RNA_pol_delta (HMM E-Value=4.7) 29 2.7 SB_27856| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_50158| Best HMM Match : Toxin_16 (HMM E-Value=2) 29 3.5 SB_38913| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_7016| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_646| Best HMM Match : MGAT2 (HMM E-Value=2.1) 29 3.5 SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_59429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_6496| Best HMM Match : Collagen (HMM E-Value=0) 29 4.7 SB_19112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 28 6.2 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 28 6.2 SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 6.2 SB_32607| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_38787| Best HMM Match : Nop17p (HMM E-Value=0.34) 28 8.1 SB_29350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) 28 8.1 SB_20965| Best HMM Match : Fz (HMM E-Value=3.1) 28 8.1 SB_4274| Best HMM Match : LRV (HMM E-Value=5.7) 28 8.1 >SB_36653| Best HMM Match : ACBP (HMM E-Value=3.6) Length = 206 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/52 (26%), Positives = 29/52 (55%) Frame = +3 Query: 33 LISLVKQNPVLYDYNNPKYMDFNAREVTWQKIGDELKRPAVDCKIRWINIRD 188 L V+ PVLYD + + D N +E W+++ ++ + K +++N+R+ Sbjct: 21 LAEAVRAFPVLYDKSIKDFKDKNKKENAWKQVAEQAGCSVDEAKRKFLNLRN 72 >SB_21719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 33.5 bits (73), Expect = 0.16 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 1/79 (1%) Frame = +1 Query: 298 PSPWTVVTAITKRKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRN 477 P+P K+ NG N+ S K+ + + S ++ Q + LT Sbjct: 42 PAPTAASAPEEKKNKKKNGEKNKEPSQKQALAEGAKDASLEIYSSFRQVFGAQLDLTSET 101 Query: 478 LRPP-TSAILAPLQNSTPL 531 +PP TS + P+Q +TP+ Sbjct: 102 RQPPETSTPVTPIQETTPI 120 >SB_25596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/66 (22%), Positives = 37/66 (56%) Frame = +3 Query: 45 VKQNPVLYDYNNPKYMDFNAREVTWQKIGDELKRPAVDCKIRWINIRDVHRRLWKKRLSD 224 V+ PVLYD + + D N +E W+++ ++ + K +++N+R+ + + K ++ Sbjct: 25 VRAFPVLYDKSIKDFKDKNKKENAWKQVAEQAGCSVDEAKRKFLNLRNRYSK-DKNKIKS 83 Query: 225 PNRSSK 242 ++S + Sbjct: 84 KSKSGE 89 >SB_15897| Best HMM Match : DUF134 (HMM E-Value=7.5) Length = 311 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = +3 Query: 33 LISLVKQNPVLYDYNNPKYMDFNAREVTWQKIGDELKRPAVDCKIRWINIRDVH-RRLWK 209 LI+L +++ LYD + Y + R + ++ I ++L + K + N+R + + +WK Sbjct: 28 LITLWREHEELYDLRHVDYPKRDRRRLAFKHISEQLGITVPEIKKKMTNLRTYYTKEIWK 87 Query: 210 KRLSDPNRSSKPYK 251 +R + +P K Sbjct: 88 ERPGGKMGTDEPSK 101 >SB_8672| Best HMM Match : PKD_channel (HMM E-Value=1.4e-38) Length = 1523 Score = 32.7 bits (71), Expect = 0.29 Identities = 17/69 (24%), Positives = 31/69 (44%) Frame = +3 Query: 198 RLWKKRLSDPNRSSKPYKYESQMAFMKAFYKDVAIPLDSGDCDYEEKDYDEWDNESGQEQ 377 R +K R K E ++ KDV++ +D D + E D ++D+E+ + Sbjct: 1236 RKLQKEAEKETRDIFKNKAEDSGGIGESINKDVSVDIDGKDENNEHDDDHDFDDENDDDY 1295 Query: 378 QENNSDSSD 404 +N+ D D Sbjct: 1296 DDNDDDDGD 1304 >SB_21967| Best HMM Match : BAG (HMM E-Value=1.7e-18) Length = 336 Score = 31.9 bits (69), Expect = 0.50 Identities = 22/89 (24%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Frame = +3 Query: 141 KRPAVDCKIRWINIRDVHRRLWKKRLSDPNRSSKPYKYESQMAFMKAFYKDVAIPLDSGD 320 K+ KI + RD + + D ++ SK + +++ + ++ AI ++ D Sbjct: 115 KKDVKQIKIIREDSRDTNEEMAVPDFKDCSKESKQ-ETNTEIPLSEIQNEEGAITSENAD 173 Query: 321 CDYEEKDYDEWDNESGQEQQ-ENNSDSSD 404 + E + DE DN GQ+ + + S+SSD Sbjct: 174 SEIEYESADEGDNSDGQQMEVDGESNSSD 202 >SB_34257| Best HMM Match : DUF1172 (HMM E-Value=1.3) Length = 304 Score = 31.5 bits (68), Expect = 0.66 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +1 Query: 331 KRKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP-TSAILA 507 K+ NG N+ S K+ + + S ++ Q + LT +PP TS + Sbjct: 4 KKNKKKNGEKNKEPSQKQALAEGAKDASLEIYSSFRQVFGAQLDLTSETRQPPETSTSVT 63 Query: 508 PLQNSTPL 531 P+Q +TP+ Sbjct: 64 PIQETTPI 71 >SB_52001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.1 bits (67), Expect = 0.87 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +3 Query: 288 KDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 KDV D DCD K + D++ G + NN D D+ Sbjct: 13 KDVGDGDDDDDCDVYYKGDGDADDDDGDDDGNNNDDDDDD 52 >SB_31911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1312 Score = 31.1 bits (67), Expect = 0.87 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 249 KYESQMAFMKAFYKDVAIPLDSGDCDYEEKDYDEWDNESGQEQQEN 386 K+ES++ M+ +Y+ V S D D D+WD + E +N Sbjct: 1077 KFESRLEMMREYYQQVETECQSTDEDPFFDPEDKWDKDFKMESPQN 1122 >SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 31.1 bits (67), Expect = 0.87 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSD 404 + D + EE+D E DN+ G+E++E D+ D Sbjct: 212 EDDDDEVEERDETENDNDEGEEREEMEDDNDD 243 >SB_34910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2147 Score = 31.1 bits (67), Expect = 0.87 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 2/81 (2%) Frame = +1 Query: 316 VTAITK--RKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP 489 VT++T+ R + + T + RS + T V +S + +ESR S +T PP Sbjct: 844 VTSVTQESRSSQVTSATQESRSTQVTSVT---QESHSTQVTSATQESRSSQVTSVTQEPP 900 Query: 490 TSAILAPLQNSTPLTRLTHSS 552 +S + + Q S P T++T ++ Sbjct: 901 SSQVTSVTQES-PSTQVTSAT 920 Score = 30.7 bits (66), Expect = 1.2 Identities = 23/89 (25%), Positives = 46/89 (51%), Gaps = 2/89 (2%) Frame = +1 Query: 292 TLPSPWTVVTAITKR--KTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHL 465 T S ++ VT++T+ + + T + RS++ T V +SR + +ESR S + Sbjct: 1328 TQESRYSQVTSVTQEPPSSQVTSVTQESRSSQVTSVT---QESRSSQVTSVTQESRSSQV 1384 Query: 466 TRRNLRPPTSAILAPLQNSTPLTRLTHSS 552 T PP++ + + Q S P +++T ++ Sbjct: 1385 TSATQEPPSTQVTSVTQES-PSSQVTSAT 1412 Score = 30.3 bits (65), Expect = 1.5 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 2/81 (2%) Frame = +1 Query: 316 VTAITKRK--TMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP 489 VT++T+ T + T + RS++ T V +SR + +ESR S +T PP Sbjct: 1180 VTSVTQESSSTQVTSATQESRSSQVTSVT---QESRSSQVTSVTQESRSSQVTSATQEPP 1236 Query: 490 TSAILAPLQNSTPLTRLTHSS 552 ++ + Q S P T++T ++ Sbjct: 1237 STQATSVTQES-PSTQVTSAT 1256 Score = 29.9 bits (64), Expect = 2.0 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 11/88 (12%) Frame = +1 Query: 292 TLPSPWTVVTAITKR--KTMMNGTTNQGRSNKRTIVI--PPMNQ-------SRKLRGGVN 438 T P T VT++T+ T + T + RS++ T V PP +Q S + Sbjct: 932 TQEPPSTQVTSVTQEPPSTQVTSATQESRSSQVTSVTQNPPSSQVTSVTQESHSTQVTSA 991 Query: 439 QKESRKSHLTRRNLRPPTSAILAPLQNS 522 +ESR S +T PP+S + + Q S Sbjct: 992 TQESRSSQVTSVTQEPPSSQVTSVTQES 1019 Score = 28.3 bits (60), Expect = 6.2 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 6/93 (6%) Frame = +1 Query: 292 TLPSPWTVVTAITKRK--TMMNGTTNQGRSNKRTIVI--PPMNQSRKLRGGVNQKESRKS 459 T SP T VT+ T+ + + T + S + T V PP Q +ESR S Sbjct: 908 TQESPSTQVTSATQESPSSQVTSVTQEPPSTQVTSVTQEPPSTQVTSAT-----QESRSS 962 Query: 460 HLTRRNLRPPTSAILAPLQ--NSTPLTRLTHSS 552 +T PP+S + + Q +ST +T T S Sbjct: 963 QVTSVTQNPPSSQVTSVTQESHSTQVTSATQES 995 >SB_21591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 31.1 bits (67), Expect = 0.87 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 D D D ++ D D+ D+E +E++E N D D+ Sbjct: 47 DDDDDDDDDDDDDDDDDEEEEEEEEENDDDDDD 79 >SB_59548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2835 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +3 Query: 318 DCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 D D ++DYD+ DN+ + ++N D +D+ Sbjct: 64 DDDDSDEDYDDDDNDDNDDDNDDNDDDNDD 93 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWD--NESGQEQQENNSDSSDE 407 D D DY++ D D+ D N+ + ++N D +D+ Sbjct: 66 DDSDEDYDDDDNDDNDDDNDDNDDDNDDNDDDNDD 100 >SB_56851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 D D DY++KD D++DN+ + ++N D D+ Sbjct: 56 DDDDDDYDDKDNDDYDND--DDVDDDNDDYDDD 86 >SB_44902| Best HMM Match : EGF (HMM E-Value=9.6e-06) Length = 335 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSD 404 D GD + +E D D D+E E E++ DS D Sbjct: 225 DDGDSEDDEDDGDSEDDEDDGEDDEDDGDSED 256 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 315 GDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 GD D EE D D D+E + +++ D D+ Sbjct: 218 GDSDDEEDDGDSEDDEDDGDSEDDEDDGEDD 248 >SB_1693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +1 Query: 331 KRKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP-TSAILA 507 K+ NG N+ S K+ + S ++ Q + LT +PP TS + Sbjct: 72 KKNKKKNGEKNKEPSQKQAFAEGAKDASLEIYSSFRQVFGAQLDLTSETRQPPETSTPVT 131 Query: 508 PLQNSTPL 531 P+Q +TP+ Sbjct: 132 PIQETTPI 139 >SB_52916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 508 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 282 FYKDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSD 395 +Y D A + D++E+ D+WD + G ++E D Sbjct: 390 WYTDAAFWKQQEEADFDEETVDDWDVDMGIYEEEGGGD 427 >SB_29898| Best HMM Match : Chromadorea_ALT (HMM E-Value=0.0085) Length = 350 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 288 KDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 KD + D G+ D E ++ E D+E G E EN ++ +E Sbjct: 37 KDEPLQEDDGEEDEETQEEPEDDSEGGTENDENPGEAENE 76 >SB_27218| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.42) Length = 175 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 D GD D ++ D D+ DN + N+ D++D+ Sbjct: 121 DGGDDDDDDDDNDDDDNNDDDDDDNNDDDNNDD 153 >SB_26379| Best HMM Match : HALZ (HMM E-Value=1.4) Length = 421 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +1 Query: 331 KRKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP-TSAILA 507 K+ NG N+ S K+ + S ++ Q + LT +PP TS + Sbjct: 72 KKNKKKNGEKNKEPSQKQAFAEGAKDASLEIYSSFRQVFGAQLDLTSETRQPPETSTPVT 131 Query: 508 PLQNSTPL 531 P+Q +TP+ Sbjct: 132 PIQETTPI 139 >SB_25550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +3 Query: 285 YKDVAIP-LDSGDCDYEEKDYDEWDNESGQEQQENN 389 Y DV +D D DY++ DYD++D+ G + ++++ Sbjct: 145 YDDVDYDDVDYDDVDYDDGDYDDYDDGGGYDDKDDD 180 >SB_20735| Best HMM Match : HALZ (HMM E-Value=4.6) Length = 259 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +1 Query: 331 KRKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP-TSAILA 507 K+ NG N+ S K+ + S ++ Q + LT +PP TS + Sbjct: 91 KKNKKKNGEKNKEPSQKQAFAEGAKDASLEIYSSFRQVFGAQLDLTSETRQPPETSTPVT 150 Query: 508 PLQNSTPL 531 P+Q +TP+ Sbjct: 151 PIQETTPI 158 >SB_37031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +3 Query: 300 IPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 + LD D D ++ D D+ DN+ + ++N D D+ Sbjct: 52 VVLDDDDDDDDDDDDDDDDNDDDNDDDDDNDDDDDD 87 >SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQEN-----NSDSSDEPI 413 D D D E+ D E D+ES ++EN NSD D+P+ Sbjct: 463 DEHDDDDEDDDDSEGDDESSNAKEENIDSDDNSDDDDKPL 502 >SB_48579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 413 + GD D DY++ D +S +NN + D + Sbjct: 123 EDGDSDVRHDDYNDEDGDSDVRHDDNNDEDGDSDV 157 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 413 + GD D +Y++ D +S +NN D D + Sbjct: 165 EDGDSDVRHDEYNDEDGDSDVRHDDNNDDDGDSDV 199 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 413 + GD D +Y++ D +S +NN D D + Sbjct: 263 EDGDSDVRHDEYNDEDGDSDVRHDDNNDDDGDSDV 297 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 413 D GD D D ++ D +S +NN D D + Sbjct: 67 DDGDSDVRHDDNNDEDGDSDVRHDDNNDDDGDSDV 101 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 413 D GD D +Y++ D +S +NN + D + Sbjct: 95 DDGDSDVRHDEYNDDDGDSDVRHDDNNDEDGDSDV 129 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 413 D GD D D ++ D +S +NN D D + Sbjct: 39 DDGDSDVRHDDNNDDDGDSDVRHDDNNDDDGDSDV 73 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 413 + GD D +Y++ D +S +NN + D + Sbjct: 221 EDGDSDVRHDEYNDEDGDSDVRHDDNNDEDGDSDV 255 >SB_43512| Best HMM Match : RNA_pol_delta (HMM E-Value=4.7) Length = 241 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 330 EEKDYDEWDNESGQEQQENNSDSSDE 407 E +D D+ D+E +E +E+ D SDE Sbjct: 199 ESEDSDDGDDEDDEEDEEDEKDESDE 224 >SB_27856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 277 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 D+G D +++DYD ++ E +N D DE Sbjct: 229 DNGHDDDDDEDYDNGHDDDDDEDYDNGHDDEDE 261 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 D+G D +++DYD ++ E +N D D+ Sbjct: 217 DNGHDDDDDEDYDNGHDDDDDEDYDNGHDDDDD 249 >SB_50158| Best HMM Match : Toxin_16 (HMM E-Value=2) Length = 746 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = +1 Query: 376 NKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPPTS-AILAPLQNSTPLTRLTHSS 552 N R + +NQ +K N+K+ R+ ++ N+ A L P+ + P+ R S+ Sbjct: 111 NNRNAALSRLNQLKKRFEAANRKQYREDYIQFMNIIINNGYAELVPVIETEPIARQRRST 170 Query: 553 SA*HQH*RLSHPII 594 + H L HP I Sbjct: 171 TWFIPHHGLYHPKI 184 >SB_38913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 D D D ++ D D+ D+E + +++N+D D+ Sbjct: 14 DDNDDDDDDDDNDDDDDEDDDDDEDDNNDDDDD 46 >SB_7016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 29.1 bits (62), Expect = 3.5 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 9/63 (14%) Frame = +3 Query: 192 HRRLWKKRLSDPNRSSKPY------KYESQMAF-MKAFYKDVAIPLD-SGDCDYEE-KDY 344 ++ LW K SD N + KP Y S +F +A Y + +PLD + +Y E K Y Sbjct: 103 NKSLWSKEASDVNSNEKPLIIQNGTHYGSASSFSYRAMYDVLELPLDWPAEVNYHEAKAY 162 Query: 345 DEW 353 W Sbjct: 163 CAW 165 >SB_646| Best HMM Match : MGAT2 (HMM E-Value=2.1) Length = 298 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 D+ D D ++++YDE D+E+ EN +D+ ++ Sbjct: 206 DNDDDDDDDENYDENDDENVGNDNENENDNEND 238 >SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2250 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 413 D GD D D ++ D +S +NN D D + Sbjct: 1802 DDGDSDVRHDDNNDEDGDSDVRHDDNNDDDGDSDV 1836 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 413 D GD D D ++ D +S +NN D D + Sbjct: 1830 DDGDSDVRHDDNNDDDGDSDVRHDDNNDDDGDSDV 1864 >SB_59429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 D D D ++ DYD+ ++S + ++N D +D+ Sbjct: 21 DDDDDDDDDDDYDDNTDDSDDDDADHNEDDNDD 53 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNE-SGQEQQENNS-DSSD 404 D GD D +E D D W+++ SG Q N S D SD Sbjct: 33 DDGDDDDDEDDDDGWESDSSGPAQPHNTSTDLSD 66 >SB_6496| Best HMM Match : Collagen (HMM E-Value=0) Length = 1234 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 + G+CD EE + E D+E E+ E +S+ S+E Sbjct: 293 EEGECDSEESEEGECDSEE-SEEGECDSEESEE 324 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 + G+CD EE + E D+E E+ E +S+ S+E Sbjct: 303 EEGECDSEESEEGECDSEE-SEEGECDSEESEE 334 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 + G+CD EE + E D+E E+ E +S+ S+E Sbjct: 313 EEGECDSEESEEGECDSEE-SEEGECDSEESEE 344 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSD 404 + G+CD EE + E D+E +E + + +S + Sbjct: 323 EEGECDSEESEEGECDSEESEEGECDTEESEE 354 >SB_19112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +3 Query: 306 LDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 +D+GD DY++ D D+ D++ + ++ D +DE Sbjct: 13 VDNGDGDYDDDD-DDNDDDDDDDDDDDGVDGNDE 45 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +3 Query: 294 VAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 V I D G+ D EE D +E D+E G+E E+ + +D+ Sbjct: 1788 VLIESDDGEDD-EEVD-EEMDDEEGEEMMEDEDEEADK 1823 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 28.3 bits (60), Expect = 6.2 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = +3 Query: 186 DVHRRLWKKRLSDPNRSSKPYKYE-SQMAFMKAFYKDVAIPLDSGDCDYEEKDYDEWDNE 362 +V RR S NRS P K S KA D+ + ++ D D D+E Sbjct: 772 EVPRRSSHMEDSSANRSISPVKERASSKPSEKAMEAPSGKAPDTKQKERKKTDSDSDDDE 831 Query: 363 SGQEQQENNSDSSD 404 S + ++ DSSD Sbjct: 832 SSESDSSDDEDSSD 845 >SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 487 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 288 KDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 KD D + D++E D S E+ ++SDSSDE Sbjct: 27 KDAETQTDPEITGVDADDFEEGDYSSSGEESGSDSDSSDE 66 >SB_32607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 309 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSD 404 D D + DYD DN + +NN+D D Sbjct: 51 DENDYVGDNNDYDSGDNNDKDDGSDNNNDDDD 82 >SB_38787| Best HMM Match : Nop17p (HMM E-Value=0.34) Length = 438 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/47 (31%), Positives = 30/47 (63%), Gaps = 5/47 (10%) Frame = +3 Query: 168 RWINIRDVHRRLW-KKRLSDPNRSS--KPY-KYES-QMAFMKAFYKD 293 RW+ + RR+W KKR + R++ +PY ++ S +A+M+ +Y++ Sbjct: 25 RWVERLNARRRIWQKKRYTKQQRTNTDEPYLRHPSYAIAWMRGYYEE 71 >SB_29350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 244 PTNMSHKWHL*RHFIKTLPSPWTVVTAITKRKTMMNGTT 360 PT +SH++H H PSP + IT T+ TT Sbjct: 100 PTPLSHRYHHRHHHTSPSPSPPYITITITITITITTITT 138 >SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) Length = 557 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 288 KDVAIPLD-SGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 407 KD + D + CD E+ D D+ N+ + + N D D+ Sbjct: 330 KDADMDSDHNNSCDDEDYDDDDVHNDDSENDDDENDDDDDD 370 >SB_20965| Best HMM Match : Fz (HMM E-Value=3.1) Length = 529 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 291 DVAIPLDSGDCDYEEKDYDE 350 DV D GDCDYE+ ++D+ Sbjct: 33 DVGGDNDGGDCDYEDDNHDD 52 >SB_4274| Best HMM Match : LRV (HMM E-Value=5.7) Length = 327 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 2/83 (2%) Frame = +3 Query: 30 TLISLVKQNPVLYDYNNPKYMDFNAREVTWQKIGDELK--RPAVDCKIRWINIRDVHRRL 203 T I + N L+++N P+Y +++ + + ELK D +I+W ++ +R+ Sbjct: 64 TFILFYQTNESLWNHNIPEYHTNRNKDLLFNCLIKELKYRYTKQDVEIKWKSLLKFYRQE 123 Query: 204 WKKRLSDPNRSSKPYKYESQMAF 272 +K P+ Y+S F Sbjct: 124 HEKAQHKPSGWGTDEVYQSSWEF 146 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,689,099 Number of Sequences: 59808 Number of extensions: 340411 Number of successful extensions: 1575 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 1362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1562 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -