BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0189 (371 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13940.1 68417.m02157 adenosylhomocysteinase / S-adenosyl-L-h... 150 3e-37 At3g23810.1 68416.m02993 adenosylhomocysteinase, putative / S-ad... 146 4e-36 At2g34360.1 68415.m04207 MATE efflux family protein similar to r... 29 1.3 At1g45191.2 68414.m05184 glycosyl hydrolase family 1 protein Sin... 29 1.3 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 27 3.0 At5g64860.1 68418.m08159 4-alpha-glucanotransferase, putative / ... 27 4.0 At2g36480.1 68415.m04477 zinc finger (C2H2-type) family protein ... 27 5.3 >At4g13940.1 68417.m02157 adenosylhomocysteinase / S-adenosyl-L-homocysteine hydrolase / AdoHcyase (SAHH) identical to SP|O23255 Adenosylhomocysteinase (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) {Arabidopsis thaliana}; strong similarity to SP|P50248 Adenosylhomocysteinase (EC 3.3.1.1) {Nicotiana sylvestris} Length = 485 Score = 150 bits (363), Expect = 3e-37 Identities = 70/117 (59%), Positives = 86/117 (73%) Frame = +1 Query: 16 YKIADEKLAEWGRKEIMLAEKEMPGLMACRRKYAPAKILKGARIAGSLHMTVQTAVLIET 195 YK+ D A++GR E+ LAE EMPGLMACR ++ P++ KGARI GSLHMT+QTAVLIET Sbjct: 14 YKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMTIQTAVLIET 73 Query: 196 LIELGAEVQWSSSNIYSTQDEAAAALVAVGIPIYAWKGETDDEYIWCIEQTLIFPDG 366 L LGAEV+W S NI+STQD AAAA+ ++AWKGET EY WC E+ L + G Sbjct: 74 LTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPG 130 >At3g23810.1 68416.m02993 adenosylhomocysteinase, putative / S-adenosyl-L-homocysteine hydrolase, putative / AdoHcyase, putative strong similarity to SP|P50248|SAHH_TOBAC Adenosylhomocysteinase (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) {Nicotiana sylvestris}; contains Pfam profile PF00670: S-adenosyl-L-homocysteine hydrolase, NAD binding domain Length = 485 Score = 146 bits (354), Expect = 4e-36 Identities = 69/117 (58%), Positives = 86/117 (73%) Frame = +1 Query: 16 YKIADEKLAEWGRKEIMLAEKEMPGLMACRRKYAPAKILKGARIAGSLHMTVQTAVLIET 195 YK+ D A++GR EI LAE EMPGL++C ++ P++ LKGARI GSLHMT+QTAVLIET Sbjct: 14 YKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMTIQTAVLIET 73 Query: 196 LIELGAEVQWSSSNIYSTQDEAAAALVAVGIPIYAWKGETDDEYIWCIEQTLIFPDG 366 L LGAEV+W S NI+STQD AAAA+ ++AWKGET EY WC E+ L + G Sbjct: 74 LTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPG 130 >At2g34360.1 68415.m04207 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 466 Score = 28.7 bits (61), Expect = 1.3 Identities = 14/49 (28%), Positives = 30/49 (61%), Gaps = 3/49 (6%) Frame = +1 Query: 136 GARIAGSLHMTVQTAVLIETLIELGAEVQWSSSN---IYSTQDEAAAAL 273 GA++ G L + +Q A+L+ TL+ + + W+++ ++ QD++ A L Sbjct: 98 GAKMYGMLGIQMQRAMLVLTLLSVPLSIVWANTEHFLVFFGQDKSIAHL 146 >At1g45191.2 68414.m05184 glycosyl hydrolase family 1 protein Since this genomic sequence region is unfinished, the annotated gene may be missing a stop codon or start codon Length = 487 Score = 28.7 bits (61), Expect = 1.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 229 SSNIYSTQDEAAAALVAVGIPIYAWKGETDDE 324 SS++YS D + GI Y W+G D++ Sbjct: 25 SSDLYSRSDFPEGFVFGAGISAYQWEGAVDED 56 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 27.5 bits (58), Expect = 3.0 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -2 Query: 340 QYTKYTRHQFLPSRHRWVFLRQPVQLRPRLVYY-KCYCWTIVPLLPILL 197 QY + LPSRHR + R+ R L + + +T +PLLP+ L Sbjct: 643 QYLHHRLRHILPSRHRHLLRRKHTIHRNHLHHNPRNLQFTALPLLPLYL 691 >At5g64860.1 68418.m08159 4-alpha-glucanotransferase, putative / disproportionating enzyme, putative similar to 4-alpha-glucanotransferase SP:Q06801 from [Solanum tuberosum] Length = 576 Score = 27.1 bits (57), Expect = 4.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 283 GIPIYAWKGETDDEYIWCIEQ 345 G P+Y WK D+Y W + + Sbjct: 339 GSPLYDWKAMESDQYSWWVNR 359 >At2g36480.1 68415.m04477 zinc finger (C2H2-type) family protein weak similarity to S-locus protein 4 (GI:6069478) [Brassica rapa]; weak similarity to Pre-mRNA cleavage complex II protein Pcf11 (Fragment) (Swiss-Prot:O94913) [Homo sapiens]; contains Prosite PS00028: Zinc finger, C2H2 type, domain Length = 828 Score = 26.6 bits (56), Expect = 5.3 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = +1 Query: 280 VGIPIYAWKGETDDEYIWCIEQTL 351 +G+P +WK ++E++W + L Sbjct: 261 IGVPYDSWKNSEEEEFMWDMHSRL 284 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.133 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,561,882 Number of Sequences: 28952 Number of extensions: 169701 Number of successful extensions: 430 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 497853200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -