BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0187 (718 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding prot... 76 1e-15 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 24 5.4 >AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding protein protein. Length = 108 Score = 75.8 bits (178), Expect = 1e-15 Identities = 33/61 (54%), Positives = 42/61 (68%) Frame = +1 Query: 472 RKGDLLHMHYTGTLDDGTEFDSSIPRGNPLTFKLGSGQVIKGWDQGLLGMCEGEQRKLVX 651 + G +HYTGTLDDGT FDSS RG P F +G G+VI+GWD+G+ M G++ KLV Sbjct: 18 KPGQTAVVHYTGTLDDGTVFDSSRTRGKPFKFSVGKGEVIRGWDEGVAQMSVGQRAKLVC 77 Query: 652 S 654 S Sbjct: 78 S 78 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -2 Query: 90 FRMIKDNRITKFFFLYNFYLLGKPRAEFLQ 1 FR+ +D+ + + + Y GKP AE L+ Sbjct: 266 FRVSEDDMLDVCYRIMALYKRGKPNAELLE 295 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 638,151 Number of Sequences: 2352 Number of extensions: 11569 Number of successful extensions: 64 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -