BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0184 (688 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0213 + 28443724-28443775,28443901-28444007,28444757-284456... 31 0.86 09_02_0187 - 5533728-5534225 29 3.5 05_06_0206 + 26369089-26369143,26369627-26369733,26369814-263706... 29 3.5 >05_07_0213 + 28443724-28443775,28443901-28444007,28444757-28445644, 28445760-28445762,28446006-28446398 Length = 480 Score = 31.1 bits (67), Expect = 0.86 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 105 NRHVVLNDVKVNGFDCIYKCLLDVNCTTMFNISTMHKL 218 NRH L VK++GF C K L+++ C + N+ ++ L Sbjct: 374 NRHDSLKTVKISGF-CSAKSLVELTCYILKNVVSLESL 410 >09_02_0187 - 5533728-5534225 Length = 165 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 8/56 (14%) Frame = +3 Query: 90 VLGYCNRH--------VVLNDVKVNGFDCIYKCLLDVNCTTMFNISTMHKLINVPS 233 VL YC +H V + D ++ FD + +DV+ T +FN+ +NVPS Sbjct: 64 VLEYCKKHAAAAAAEDVAVKDQELKSFDASF---IDVDNTMLFNLILAANYLNVPS 116 >05_06_0206 + 26369089-26369143,26369627-26369733,26369814-26370647, 26370781-26370939,26371070-26371410,26373894-26373991, 26374244-26374350,26374715-26375266,26375366-26375524, 26375631-26376005 Length = 928 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +3 Query: 105 NRHVVLNDVKVNGFDCIYKCLLDVNCTTMFNISTMHKL 218 +RHV L +VK+ GF C K ++++ C + N +++ L Sbjct: 409 HRHVNLKNVKIIGF-CSAKSMVELTCHIIENATSLESL 445 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,265,003 Number of Sequences: 37544 Number of extensions: 306324 Number of successful extensions: 570 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -