Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0184
         (688 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

S55985-1|AAB19791.2|  530|Homo sapiens UDP-glucuronosyltransfera...    31   5.1  

>S55985-1|AAB19791.2|  530|Homo sapiens UDP-glucuronosyltransferase
           protein.
          Length = 530

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 18/72 (25%), Positives = 34/72 (47%)
 Frame = +3

Query: 6   IGTRVVITNVVESNIFNKAVIWHSAGTFVLGYCNRHVVLNDVKVNGFDCIYKCLLDVNCT 185
           I + ++ T V E ++++   IW     FVL Y  + V+ N + + G +C  +  L +   
Sbjct: 230 IASEILQTPVTEYDLYSHTSIWLLRTDFVLDY-PKPVMPNMIFIGGINCHERKALPMEFE 288

Query: 186 TMFNISTMHKLI 221
              N S  H ++
Sbjct: 289 AYINASGEHGIV 300


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,517,366
Number of Sequences: 237096
Number of extensions: 1791900
Number of successful extensions: 2974
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2909
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2974
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7839245960
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)