BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0183 (702 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 2.8 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 2.8 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 4.9 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +1 Query: 67 YGVPDIDVFQTVDLWEKKDI--AQVVSTLF 150 Y D D+F LW K +I AQ + +L+ Sbjct: 116 YHAKDFDIFFKTALWAKNNINEAQYIYSLY 145 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +1 Query: 67 YGVPDIDVFQTVDLWEKKDI--AQVVSTLF 150 Y D D+F LW K +I AQ + +L+ Sbjct: 116 YHAKDFDIFFKTALWAKNNINEAQYIYSLY 145 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 257 PGKL*SVCKLDLTREPLNPDR 319 PG S CK+D+T P + R Sbjct: 141 PGIFKSTCKIDITWFPFDDQR 161 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,624 Number of Sequences: 438 Number of extensions: 4515 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -