BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0183 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67910.1 68414.m07755 expressed protein 29 2.3 At5g02790.1 68418.m00221 In2-1 protein, putative similar to In2-... 29 3.0 At5g02780.1 68418.m00220 In2-1 protein, putative similar to In2-... 29 3.0 At1g63350.1 68414.m07161 disease resistance protein (CC-NBS-LRR ... 28 5.2 At5g07640.1 68418.m00875 zinc finger (C3HC4-type RING finger) fa... 28 6.9 At3g18930.2 68416.m02403 zinc finger (C3HC4-type RING finger) fa... 28 6.9 At3g18930.1 68416.m02402 zinc finger (C3HC4-type RING finger) fa... 28 6.9 At3g08590.2 68416.m00998 2,3-biphosphoglycerate-independent phos... 28 6.9 At3g08590.1 68416.m00997 2,3-biphosphoglycerate-independent phos... 28 6.9 At1g09780.1 68414.m01097 2,3-biphosphoglycerate-independent phos... 28 6.9 At4g09700.1 68417.m01594 hypothetical protein similar to zinc fi... 27 9.1 At1g01220.1 68414.m00036 GHMP kinase-related contains similarity... 27 9.1 >At1g67910.1 68414.m07755 expressed protein Length = 91 Score = 29.5 bits (63), Expect = 2.3 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 124 CLFSPIDLRFGTHRCRVHRML*LQ-TGSL*CSPSFDLVPIPA 2 CL SP G+ RCR+HR L LQ T S+ + D P PA Sbjct: 44 CLCSPTT-HPGSFRCRIHRSLSLQRTKSIEAASLLDSPPKPA 84 >At5g02790.1 68418.m00221 In2-1 protein, putative similar to In2-1, Zea mays, EMBL:X58573 Length = 235 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +1 Query: 169 YRHAEWSGPCLGPKPADECKRDFSDEVLKAGQTVIGLQAGSNKG 300 Y + GP L P+ D KR+F DE+LK T + S KG Sbjct: 99 YLDNTFEGPSLYPE--DHAKREFGDELLKYTDTFVKTMYVSLKG 140 >At5g02780.1 68418.m00220 In2-1 protein, putative similar to In2-1 [Zea mays] EMBL:X58573 Length = 237 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 169 YRHAEWSGPCLGPKPADECKRDFSDEVLK-AGQTVIGLQAGSNKG 300 Y + + GP L P+ D KR+F +E+LK +T + GS KG Sbjct: 101 YVDSNFDGPSLYPE--DSAKREFGEELLKYVDETFVKTVFGSFKG 143 >At1g63350.1 68414.m07161 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 898 Score = 28.3 bits (60), Expect = 5.2 Identities = 30/96 (31%), Positives = 44/96 (45%), Gaps = 6/96 (6%) Frame = -1 Query: 270 HSLPGLQDFIRKVTFAFV---SGLGSEAGAAPFRVSVSLTTEGKQCADYLGDVFFLP*IY 100 H GLQ+ ++K+ ++ S LGS G + L G + Y D+ + + Sbjct: 599 HLPKGLQE-LKKLIHLYLERTSQLGSMVGISCLHNLKVLKLSG---SSYAWDLDTVKELE 654 Query: 99 GLEHIDVGYTVCFDCRLEVCDVL--HHLTSC-RFLQ 1 LEH++V T DC L L H L SC RFL+ Sbjct: 655 ALEHLEVLTTTIDDCTLGTDQFLSSHRLMSCIRFLK 690 >At5g07640.1 68418.m00875 zinc finger (C3HC4-type RING finger) family protein contains a zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 and a IBR domain, Pfam:PF01485 Length = 316 Score = 27.9 bits (59), Expect = 6.9 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = -2 Query: 323 RFCPD*VAPLLDPA---CRPITVCPAFRTSSEKSRLHSSAGLGPRQ 195 RFC D + D A +P+ CP+F +SE R L P+Q Sbjct: 178 RFCFDCIKKQADVALEFAKPVVNCPSFGCNSELQREDCEGVLKPKQ 223 >At3g18930.2 68416.m02403 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 411 Score = 27.9 bits (59), Expect = 6.9 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 136 LLGRCLFSPIDLRFGTHRCRVHRML*LQTGSL*CSPSFDL 17 L+ R SP+ RF RCR R+L L + S + S DL Sbjct: 61 LISRRFLSPLFRRFRRWRCRRRRLLHLSSASSASTSSSDL 100 >At3g18930.1 68416.m02402 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 411 Score = 27.9 bits (59), Expect = 6.9 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 136 LLGRCLFSPIDLRFGTHRCRVHRML*LQTGSL*CSPSFDL 17 L+ R SP+ RF RCR R+L L + S + S DL Sbjct: 61 LISRRFLSPLFRRFRRWRCRRRRLLHLSSASSASTSSSDL 100 >At3g08590.2 68416.m00998 2,3-biphosphoglycerate-independent phosphoglycerate mutase, putative / phosphoglyceromutase, putative strong similarity to SP|Q42908 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) {Mesembryanthemum crystallinum}; contains Pfam profile PF01676: Metalloenzyme superfamily Length = 560 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +1 Query: 205 PKPADECKRDFSDE---VLKAGQTVIGLQAGSNKGATQSGQN-LGAGR 336 P PA + +D + ++KA T +GL + + G ++ G N LGAGR Sbjct: 46 PTPAMDSLKDGKPDTWRLIKAHGTAVGLPSEDDMGNSEVGHNALGAGR 93 >At3g08590.1 68416.m00997 2,3-biphosphoglycerate-independent phosphoglycerate mutase, putative / phosphoglyceromutase, putative strong similarity to SP|Q42908 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) {Mesembryanthemum crystallinum}; contains Pfam profile PF01676: Metalloenzyme superfamily Length = 560 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +1 Query: 205 PKPADECKRDFSDE---VLKAGQTVIGLQAGSNKGATQSGQN-LGAGR 336 P PA + +D + ++KA T +GL + + G ++ G N LGAGR Sbjct: 46 PTPAMDSLKDGKPDTWRLIKAHGTAVGLPSEDDMGNSEVGHNALGAGR 93 >At1g09780.1 68414.m01097 2,3-biphosphoglycerate-independent phosphoglycerate mutase, putative / phosphoglyceromutase, putative strong similarity to SP|Q42908 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) {Mesembryanthemum crystallinum}; contains Pfam profile PF01676: Metalloenzyme superfamily Length = 557 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +1 Query: 205 PKPA-DECKRDFSDE--VLKAGQTVIGLQAGSNKGATQSGQN-LGAGR 336 P PA D K D ++KA T +GL + + G ++ G N LGAGR Sbjct: 44 PTPAMDSLKHGAPDTWTLIKAHGTAVGLPSEDDMGNSEVGHNALGAGR 91 >At4g09700.1 68417.m01594 hypothetical protein similar to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 371 Score = 27.5 bits (58), Expect = 9.1 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 3 AGIGTRSNDGEHHKLPVCNQSIRCTRHRCVPNRRSMGEKRHRPSSQ 140 +G +D H + C++ I+ + H V RRS +H PSS+ Sbjct: 327 SGFDLHPHDRSHPRRIACDEEIQSSSHNLVSGRRS----QHLPSSR 368 >At1g01220.1 68414.m00036 GHMP kinase-related contains similarity to L-fucose kinase [Homo sapiens] gi|21212956|emb|CAD29647 Length = 1055 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +2 Query: 5 RNRHEVK*WRTSQTSSLQSKH-TVYPTSMCS 94 RN+ ++K WR+SQ SL+ H ++ MC+ Sbjct: 546 RNKEKIKLWRSSQRVSLEELHGSINFPEMCN 576 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,095,077 Number of Sequences: 28952 Number of extensions: 316853 Number of successful extensions: 716 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 716 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -