SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0180
         (528 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc...    25   1.2  
AY146743-1|AAO12103.1|  192|Anopheles gambiae odorant-binding pr...    25   1.2  
AY146747-1|AAO12062.1|  288|Anopheles gambiae odorant-binding pr...    23   4.8  
AJ618931-1|CAF02009.1|  288|Anopheles gambiae odorant-binding pr...    23   4.8  
EF519384-1|ABP68493.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519383-1|ABP68492.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519382-1|ABP68491.1|  493|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519381-1|ABP68490.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519380-1|ABP68489.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519376-1|ABP68485.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519375-1|ABP68484.1|  493|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519374-1|ABP68483.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519373-1|ABP68482.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519372-1|ABP68481.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519371-1|ABP68480.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519369-1|ABP68478.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519368-1|ABP68477.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519367-1|ABP68476.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519366-1|ABP68475.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519365-1|ABP68474.1|  486|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519364-1|ABP68473.1|  496|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519363-1|ABP68472.1|  503|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519362-1|ABP68471.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519361-1|ABP68470.1|  497|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519360-1|ABP68469.1|  499|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519359-1|ABP68468.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519358-1|ABP68467.1|  497|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519357-1|ABP68466.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519356-1|ABP68465.1|  500|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519355-1|ABP68464.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519354-1|ABP68463.1|  506|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519353-1|ABP68462.1|  470|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519352-1|ABP68461.1|  448|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519351-1|ABP68460.1|  486|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519350-1|ABP68459.1|  421|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519349-1|ABP68458.1|  486|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519348-1|ABP68457.1|  503|Anopheles gambiae LRIM1 protein.           23   8.4  
EF519347-1|ABP68456.1|  470|Anopheles gambiae LRIM1 protein.           23   8.4  
EF117201-1|ABL67438.1|  481|Anopheles gambiae serpin 17 protein.       23   8.4  
AF510719-1|AAP47148.1|  591|Anopheles gambiae ammonium transport...    23   8.4  

>EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium
            channel alpha2-delta subunit 1 protein.
          Length = 1256

 Score = 25.4 bits (53), Expect = 1.2
 Identities = 16/52 (30%), Positives = 23/52 (44%)
 Frame = +3

Query: 231  PLLDFQQVSFSVTRPCTSMNDQEKPKREEEKKVGLIQRFKEMYRDYWYVLLP 386
            PL+D+Q +      P T   +  KP R       L+Q F   +  YW  +LP
Sbjct: 997  PLMDYQGICSDRDNPYTGAGEPLKPVRPMS---WLLQYFVS-FATYWLSVLP 1044


>AY146743-1|AAO12103.1|  192|Anopheles gambiae odorant-binding
           protein AgamOBP11 protein.
          Length = 192

 Score = 25.4 bits (53), Expect = 1.2
 Identities = 14/32 (43%), Positives = 16/32 (50%)
 Frame = +3

Query: 204 CCHHNFVNRPLLDFQQVSFSVTRPCTSMNDQE 299
           CC  NF NR L+  QQ S      CT+   QE
Sbjct: 126 CCE-NFSNRHLVCLQQNSLPCPDRCTAAYKQE 156


>AY146747-1|AAO12062.1|  288|Anopheles gambiae odorant-binding
           protein AgamOBP42 protein.
          Length = 288

 Score = 23.4 bits (48), Expect = 4.8
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -1

Query: 432 YNSSYRTIQRKSP 394
           YN +YR I+RK+P
Sbjct: 104 YNRTYRCIERKAP 116


>AJ618931-1|CAF02009.1|  288|Anopheles gambiae odorant-binding
           protein OBPjj83d protein.
          Length = 288

 Score = 23.4 bits (48), Expect = 4.8
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -1

Query: 432 YNSSYRTIQRKSP 394
           YN +YR I+RK+P
Sbjct: 104 YNRTYRCIERKAP 116


>EF519384-1|ABP68493.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519383-1|ABP68492.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519382-1|ABP68491.1|  493|Anopheles gambiae LRIM1 protein.
          Length = 493

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519381-1|ABP68490.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519380-1|ABP68489.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519376-1|ABP68485.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519375-1|ABP68484.1|  493|Anopheles gambiae LRIM1 protein.
          Length = 493

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519374-1|ABP68483.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519373-1|ABP68482.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519372-1|ABP68481.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519371-1|ABP68480.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519369-1|ABP68478.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519368-1|ABP68477.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519367-1|ABP68476.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519366-1|ABP68475.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519365-1|ABP68474.1|  486|Anopheles gambiae LRIM1 protein.
          Length = 486

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519364-1|ABP68473.1|  496|Anopheles gambiae LRIM1 protein.
          Length = 496

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519363-1|ABP68472.1|  503|Anopheles gambiae LRIM1 protein.
          Length = 503

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519362-1|ABP68471.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519361-1|ABP68470.1|  497|Anopheles gambiae LRIM1 protein.
          Length = 497

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519360-1|ABP68469.1|  499|Anopheles gambiae LRIM1 protein.
          Length = 499

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519359-1|ABP68468.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519358-1|ABP68467.1|  497|Anopheles gambiae LRIM1 protein.
          Length = 497

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519357-1|ABP68466.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519356-1|ABP68465.1|  500|Anopheles gambiae LRIM1 protein.
          Length = 500

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519355-1|ABP68464.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519354-1|ABP68463.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519353-1|ABP68462.1|  470|Anopheles gambiae LRIM1 protein.
          Length = 470

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519352-1|ABP68461.1|  448|Anopheles gambiae LRIM1 protein.
          Length = 448

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519351-1|ABP68460.1|  486|Anopheles gambiae LRIM1 protein.
          Length = 486

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519350-1|ABP68459.1|  421|Anopheles gambiae LRIM1 protein.
          Length = 421

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519349-1|ABP68458.1|  486|Anopheles gambiae LRIM1 protein.
          Length = 486

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519348-1|ABP68457.1|  503|Anopheles gambiae LRIM1 protein.
          Length = 503

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF519347-1|ABP68456.1|  470|Anopheles gambiae LRIM1 protein.
          Length = 470

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 365 LLVCVTSSTHG 397
           LLVCVT++ HG
Sbjct: 12  LLVCVTATVHG 22


>EF117201-1|ABL67438.1|  481|Anopheles gambiae serpin 17 protein.
          Length = 481

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/15 (53%), Positives = 13/15 (86%)
 Frame = +2

Query: 470 VPRSHRDTLKTAERI 514
           VP+S ++T+KT E+I
Sbjct: 62  VPKSQQETIKTYEKI 76


>AF510719-1|AAP47148.1|  591|Anopheles gambiae ammonium
           transport-like protein protein.
          Length = 591

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 7/29 (24%), Positives = 13/29 (44%)
 Frame = +1

Query: 346 LKKCTGITGMCYFQYTWRLPLYGSVAAII 432
           L     +T  CY  + W   L G++ + +
Sbjct: 307 LASLVSVTAGCYLYHAWEAILIGAIGSAL 335


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 537,545
Number of Sequences: 2352
Number of extensions: 11257
Number of successful extensions: 52
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 52
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 48628785
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -