BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0180 (528 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 1.2 AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding pr... 25 1.2 AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding pr... 23 4.8 AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding pr... 23 4.8 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 23 8.4 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 23 8.4 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 23 8.4 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 23 8.4 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 23 8.4 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 23 8.4 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 23 8.4 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 23 8.4 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 23 8.4 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 23 8.4 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 23 8.4 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 23 8.4 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 23 8.4 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 23 8.4 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 23 8.4 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 23 8.4 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 23 8.4 EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. 23 8.4 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 23 8.4 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 25.4 bits (53), Expect = 1.2 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +3 Query: 231 PLLDFQQVSFSVTRPCTSMNDQEKPKREEEKKVGLIQRFKEMYRDYWYVLLP 386 PL+D+Q + P T + KP R L+Q F + YW +LP Sbjct: 997 PLMDYQGICSDRDNPYTGAGEPLKPVRPMS---WLLQYFVS-FATYWLSVLP 1044 >AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding protein AgamOBP11 protein. Length = 192 Score = 25.4 bits (53), Expect = 1.2 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 204 CCHHNFVNRPLLDFQQVSFSVTRPCTSMNDQE 299 CC NF NR L+ QQ S CT+ QE Sbjct: 126 CCE-NFSNRHLVCLQQNSLPCPDRCTAAYKQE 156 >AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding protein AgamOBP42 protein. Length = 288 Score = 23.4 bits (48), Expect = 4.8 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 432 YNSSYRTIQRKSP 394 YN +YR I+RK+P Sbjct: 104 YNRTYRCIERKAP 116 >AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding protein OBPjj83d protein. Length = 288 Score = 23.4 bits (48), Expect = 4.8 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 432 YNSSYRTIQRKSP 394 YN +YR I+RK+P Sbjct: 104 YNRTYRCIERKAP 116 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 365 LLVCVTSSTHG 397 LLVCVT++ HG Sbjct: 12 LLVCVTATVHG 22 >EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. Length = 481 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +2 Query: 470 VPRSHRDTLKTAERI 514 VP+S ++T+KT E+I Sbjct: 62 VPKSQQETIKTYEKI 76 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 22.6 bits (46), Expect = 8.4 Identities = 7/29 (24%), Positives = 13/29 (44%) Frame = +1 Query: 346 LKKCTGITGMCYFQYTWRLPLYGSVAAII 432 L +T CY + W L G++ + + Sbjct: 307 LASLVSVTAGCYLYHAWEAILIGAIGSAL 335 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 537,545 Number of Sequences: 2352 Number of extensions: 11257 Number of successful extensions: 52 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -