BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0175 (548 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0125 + 8738770-8739237,8739266-8739742 27 7.5 05_07_0075 - 27513927-27514220,27514806-27515117,27515203-275153... 27 9.9 >05_03_0125 + 8738770-8739237,8739266-8739742 Length = 314 Score = 27.5 bits (58), Expect = 7.5 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 231 EGANSKKSQT*AETVGPSDGVKQNHGEKGAK 323 EGAN + E G DGVK NH + G K Sbjct: 181 EGANPSAEE---EAAGRRDGVKPNHSDGGEK 208 >05_07_0075 - 27513927-27514220,27514806-27515117,27515203-27515342, 27515502-27515565,27515637-27516083,27516169-27516303, 27517620-27517737,27517857-27517876 Length = 509 Score = 27.1 bits (57), Expect = 9.9 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -2 Query: 460 KKEFPDIFFPRTASTKRGI--SSVSGPLDEHSNDVLFFFDM 344 +K+ PD F R + + + ++GP +D LFFFD+ Sbjct: 257 EKDLPDTIFVRAYEDRMDLLRAVITGPAGTPYHDGLFFFDI 297 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,585,807 Number of Sequences: 37544 Number of extensions: 222457 Number of successful extensions: 548 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -