BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0174 (670 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 24 0.98 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 4.0 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 4.0 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 22 4.0 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 5.2 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 21 9.1 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 21 9.1 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 24.2 bits (50), Expect = 0.98 Identities = 12/45 (26%), Positives = 26/45 (57%) Frame = +1 Query: 295 LRPLPFRRLQTGLTILSKYPVHQHLMLTVCWMMLHWDPLQQQYSN 429 L+ L R+++ L L + ++ +LT+C+ + +W +QQY + Sbjct: 87 LKLLKGRKIRKNLYYLLLFVINVLYVLTLCYAVYYW---RQQYED 128 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/39 (20%), Positives = 24/39 (61%) Frame = +3 Query: 531 LQIAKKELEDWYKSHEEQISKTKAANRESAKNAERAQAR 647 L + +++++ W+++ ++ K A +E + ++AQA+ Sbjct: 260 LCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQ 298 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 183 MDDFGDSFVEPEVDPAADFLAREQNQL 263 +D FG + E + P ++R+QN L Sbjct: 472 VDQFGAEWAETTIIPKVLAMSRDQNYL 498 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/39 (20%), Positives = 24/39 (61%) Frame = +3 Query: 531 LQIAKKELEDWYKSHEEQISKTKAANRESAKNAERAQAR 647 L + +++++ W+++ ++ K A +E + ++AQA+ Sbjct: 42 LCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQ 80 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.8 bits (44), Expect = 5.2 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = +3 Query: 360 SAFDA-NGLLDDA--PLGSTPTTVFKQEREEPEKIK 458 + FD N L+D PLG + + FKQ+ EE +K Sbjct: 26 TVFDIPNDYLNDKYKPLGVSLSNRFKQDAEETVPVK 61 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = +3 Query: 555 EDWYKSHEEQISKTKAANRESAKNAERAQ---ARGSESSVE 668 +D+ K H+ IS A R ERA+ + +++S+E Sbjct: 71 QDFKKKHKADISGNPRALRRLRTQCERAKRTLSSATQASIE 111 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = +3 Query: 555 EDWYKSHEEQISKTKAANRESAKNAERAQ---ARGSESSVE 668 +D+ K H+ IS A R ERA+ + +++S+E Sbjct: 71 QDFKKKHKADISGNPRALRRLRTQCERAKRTLSSATQASIE 111 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,435 Number of Sequences: 336 Number of extensions: 2792 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -