BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0172 (527 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G9.09c |rpl24||60S ribosomal protein L24|Schizosaccharomyce... 99 2e-22 SPCC330.14c |rpl2402|rpl24-2|60S ribosomal protein L24|Schizosac... 99 2e-22 SPAC22E12.13c |rpl2403|rpl24-3|60S ribosomal protein L24-3 |Schi... 62 5e-11 SPBC337.07c |||carboxypeptidase |Schizosaccharomyces pombe|chr 2... 27 2.3 SPBC1E8.05 |||conserved fungal protein|Schizosaccharomyces pombe... 25 7.0 SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 25 9.2 >SPAC6G9.09c |rpl24||60S ribosomal protein L24|Schizosaccharomyces pombe|chr 1|||Manual Length = 149 Score = 99 bits (238), Expect = 2e-22 Identities = 46/100 (46%), Positives = 62/100 (62%) Frame = +1 Query: 22 VKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFK 201 +K+ +C++SG K+YPG G+ V+ D K F F+N K E+ L R+NPR+++WTVLYRR K Sbjct: 1 MKVEVCSFSGSKVYPGAGRLFVRGDNKVFRFVNKKSESLFLQRKNPRRLSWTVLYRRMHK 60 Query: 202 KGQEEEXXXXXXXXXXXXXXXIVGASLSDIMAKRNMKPEV 321 KG EE IVGA+L I KRN +PEV Sbjct: 61 KGISEEHAKKRTRRTVKHQRGIVGANLDVIKEKRNQRPEV 100 >SPCC330.14c |rpl2402|rpl24-2|60S ribosomal protein L24|Schizosaccharomyces pombe|chr 3|||Manual Length = 149 Score = 99 bits (238), Expect = 2e-22 Identities = 46/100 (46%), Positives = 62/100 (62%) Frame = +1 Query: 22 VKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFK 201 +K+ +C++SG K+YPG G+ V+ D K F F+N K E+ L R+NPR+++WTVLYRR K Sbjct: 1 MKVEVCSFSGSKVYPGAGRLFVRGDNKVFRFVNKKSESLFLQRKNPRRLSWTVLYRRMHK 60 Query: 202 KGQEEEXXXXXXXXXXXXXXXIVGASLSDIMAKRNMKPEV 321 KG EE IVGA+L I KRN +PEV Sbjct: 61 KGISEEHAKKRTRRTVKHQRGIVGANLDVIKEKRNQRPEV 100 >SPAC22E12.13c |rpl2403|rpl24-3|60S ribosomal protein L24-3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 192 Score = 62.1 bits (144), Expect = 5e-11 Identities = 26/61 (42%), Positives = 34/61 (55%) Frame = +1 Query: 22 VKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFK 201 +++ C + +YPGHG V+ D K F F SKC M+RNPRKV WT YR+ Sbjct: 1 MRVHTCYFCSGPVYPGHGIMFVRNDSKVFRFCRSKCHKNFKMKRNPRKVAWTKAYRKAHG 60 Query: 202 K 204 K Sbjct: 61 K 61 >SPBC337.07c |||carboxypeptidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 497 Score = 26.6 bits (56), Expect = 2.3 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -3 Query: 108 EGFSIHFNHGLAMAWIYFVSTIGAKSDLHLQ 16 +GF H+ G A+ W+YF + + ++ L+ Sbjct: 430 DGFHKHYLPGTAIDWVYFAADVAWPFNIRLR 460 >SPBC1E8.05 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 317 Score = 25.0 bits (52), Expect = 7.0 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 359 FAALMACSLCALRTSGFILRLAIMSLSEAPTI 264 + L ACS C + TS I S S AP++ Sbjct: 105 YFTLQACSTCTISTSSLSYSGTISSTSIAPSM 136 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 24.6 bits (51), Expect = 9.2 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +2 Query: 47 VDTKYIQAMARPWLKWM 97 V+ K+IQ + + W+KW+ Sbjct: 137 VEQKWIQFLHKSWMKWL 153 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,654,261 Number of Sequences: 5004 Number of extensions: 30681 Number of successful extensions: 82 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 216376042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -