BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0171 (390 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 23 3.0 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 22 6.9 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 22 6.9 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 22 6.9 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 22 6.9 DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor... 22 9.1 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 23.4 bits (48), Expect = 3.0 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 197 ETGKIKTFCREKGHGFVKPEKGGEDIFLHISDIEGEYVPLPGDEVIYR 340 E+ I TF + HG + G ++ I++IE + L + +YR Sbjct: 136 ESDIIMTFLNKNHHGSEMRHEKGRRLWFGIANIEDDVSVLMAELRLYR 183 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 22.2 bits (45), Expect = 6.9 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = +2 Query: 128 PSPIITRRNRTASTSERALGNPLETGKIKTFCREKGHG 241 PSP +R+ RT + + +GK T + +G Sbjct: 413 PSPKSSRKRRTGHRPPAGMNASMSSGKRSTATHQAEYG 450 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 22.2 bits (45), Expect = 6.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -1 Query: 348 GQSRYITSSPGRGTYSPSISDIWRNISSPP 259 G S +SS G SPS S I SPP Sbjct: 755 GSSSTASSSVSTGMPSPSRSAFADGIGSPP 784 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 50 GIHQHVQEQVYAE--LRQIF 67 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 50 GIHQHVQEQVYAE--LRQIF 67 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 50 GIHQHVQEQVYAE--LRQIF 67 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 50 GIHQHVQEQVYAE--LRQIF 67 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 53 GIHQHVQEQVYAE--LRQIF 70 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 53 GIHQHVQEQVYAE--LRQIF 70 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 62 GIHQHVQEQVYAE--LRQIF 79 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 62 GIHQHVQEQVYAE--LRQIF 79 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 64 GIHQHVQEQVYAE--LRQIF 81 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 64 GIHQHVQEQVYAE--LRQIF 81 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 50 GIHQHVQEQVYAE--LRQIF 67 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 50 GIHQHVQEQVYAE--LRQIF 67 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 64 GIHQHVQEQVYAE--LRQIF 81 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 64 GIHQHVQEQVYAE--LRQIF 81 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 62 GIHQHVQEQVYAE--LRQIF 79 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 62 GIHQHVQEQVYAE--LRQIF 79 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 64 GIHQHVQEQVYAE--LRQIF 81 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 64 GIHQHVQEQVYAE--LRQIF 81 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 62 GIHQHVQEQVYAE--LRQIF 79 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 62 GIHQHVQEQVYAE--LRQIF 79 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 49 GIHQHVQEQVYAE--LRQIF 66 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 49 GIHQHVQEQVYAE--LRQIF 66 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 62 GIHQHVQEQVYAE--LRQIF 79 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 62 GIHQHVQEQVYAE--LRQIF 79 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 62 GIHQHVQEQVYAE--LRQIF 79 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 62 GIHQHVQEQVYAE--LRQIF 79 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 63 GIHQHVQEQVYAE--LRQIF 80 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 63 GIHQHVQEQVYAE--LRQIF 80 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 61 GIHQHVQEQVYAE--LRQIF 78 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 314 GVHIHLRYQIYGEIYLRPLF 255 G+H H++ Q+Y E LR +F Sbjct: 25 GIHQHVQEQVYAE--LRQIF 42 >DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGIFKFQRKILLIFGC 34 >DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 >DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 216 VLILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + + PV++ P+ D +F+R I+ + C Sbjct: 3 ITVAPVTDARPQTPEDCGMFKFQRKILLIFGC 34 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 404,546 Number of Sequences: 2352 Number of extensions: 7982 Number of successful extensions: 107 Number of sequences better than 10.0: 102 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30356973 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -