BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0171 (390 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 2.2 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 2.2 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 5.0 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 5.0 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 5.0 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 5.0 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 5.0 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 5.0 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 5.0 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 21 5.0 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 21 5.0 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 5.0 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 5.0 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 5.0 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 5.0 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 5.0 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 5.0 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 5.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 5.0 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 5.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 5.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 5.0 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 21 6.6 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 21 6.6 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 6.6 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 2.2 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -2 Query: 176 FLMSTLFDFAE 144 FLM ++FDFAE Sbjct: 315 FLMDSMFDFAE 325 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 2.2 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 340 SIYNFITRQGYIFTFDIRYMEKYIFAPFFRF 248 S+Y+ R+ T D + +KY P+F F Sbjct: 196 SVYSKTRRRALEHTLDRFHNDKYSNVPYFLF 226 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 116 VPGSRHIGPLTPFPPRF 132 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 116 VPGSRHIGPLTPFPPRF 132 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 116 VPGSRHIGPLTPFPPRF 132 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 116 VPGSRHIGPLTPFPPRF 132 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 116 VPGSRHIGPLTPFPPRF 132 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 116 VPGSRHIGPLTPFPPRF 132 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 116 VPGSRHIGPLTPFPPRF 132 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 21.0 bits (42), Expect = 5.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 77 GFNSDDSPNKTNSHLQLPSPIITRRN 154 G N + N SHL LP+P I ++ Sbjct: 32 GMNQCQAVNGHCSHLCLPAPRINSKS 57 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 21.0 bits (42), Expect = 5.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 77 GFNSDDSPNKTNSHLQLPSPIITRRN 154 G N + N SHL LP+P I ++ Sbjct: 32 GMNQCQAVNGHCSHLCLPAPRINSKS 57 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 365 VPGSRHIGPLTPFPPRF 381 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 365 VPGSRHIGPLTPFPPRF 381 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 365 VPGSRHIGPLTPFPPRF 381 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 365 VPGSRHIGPLTPFPPRF 381 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 365 VPGSRHIGPLTPFPPRF 381 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 365 VPGSRHIGPLTPFPPRF 381 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 364 VPGSRHIGPLTPFPPRF 380 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 349 VPGSRHIGPLTPFPPRF 365 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 314 LPGDEVIYRLCPIPPKF 364 +PG I L P PP+F Sbjct: 365 VPGSRHIGPLTPFPPRF 381 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 5.0 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = -1 Query: 306 YSPSISDIWRNI 271 Y P ++D+WR++ Sbjct: 1151 YEPILADMWRSV 1162 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 5.0 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = -1 Query: 306 YSPSISDIWRNI 271 Y P ++D+WR++ Sbjct: 1147 YEPILADMWRSV 1158 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 20.6 bits (41), Expect = 6.6 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -1 Query: 210 ILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + P+ + +DV R GLGNC Sbjct: 133 VYPLDFARTRLAADVGKAGGEREFTGLGNC 162 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 20.6 bits (41), Expect = 6.6 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -1 Query: 210 ILPVSNGLPKALSDVDAVRFRRVIIGLGNC 121 + P+ + +DV R GLGNC Sbjct: 133 VYPLDFARTRLAADVGKAGGEREFTGLGNC 162 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 20.6 bits (41), Expect = 6.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 236 HGFVKPEKGGEDIFLHISDIEG 301 HG V E GGE + IS ++G Sbjct: 272 HGIVIEELGGEIQCVKISALKG 293 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,667 Number of Sequences: 438 Number of extensions: 2389 Number of successful extensions: 25 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9514659 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -