BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0170 (719 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0432 - 24231984-24233048,24233391-24235160,24235261-242365... 45 5e-05 09_06_0076 + 20710482-20710670,20711313-20711547,20711664-207116... 31 0.92 05_07_0329 - 29308867-29308932,29309040-29309159,29309245-293093... 31 0.92 09_04_0087 + 14476539-14476675,14478876-14479635,14479720-144798... 31 1.2 01_06_1535 + 38057802-38057999,38058338-38058437,38058730-380588... 30 1.6 11_06_0634 - 25685216-25685329,25685407-25685511,25685681-256857... 29 2.8 10_08_0374 - 17312430-17312513,17312794-17313029,17313081-173132... 29 2.8 03_05_0371 + 23570246-23570359,23570499-23570575,23570600-235706... 29 2.8 08_02_0672 - 19904353-19904839,19905646-19905704,19906137-199063... 29 3.7 03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838,235... 29 3.7 10_01_0126 + 1511963-1512052,1513440-1513785,1513884-1515010 29 4.9 07_03_0011 + 12370624-12370684,12372573-12372718,12372793-123731... 29 4.9 03_06_0422 + 33818887-33819996 29 4.9 03_01_0192 - 1534013-1535147,1535249-1535370,1535497-1535556,153... 29 4.9 01_06_0213 + 27580635-27581105,27581206-27581298,27581376-275815... 29 4.9 11_02_0022 + 7461902-7462951 28 6.5 10_01_0030 - 386008-388056,388166-388360,388931-389062,389167-38... 28 8.6 09_01_0102 + 1582793-1582898,1582988-1583093,1584115-1584172,158... 28 8.6 05_01_0355 - 2774217-2774318,2774608-2774775,2774872-2775090,277... 28 8.6 04_04_1509 - 34074206-34074398,34074506-34074777,34075411-340756... 28 8.6 03_01_0373 - 2904914-2904949,2905030-2905144,2906446-2906534,290... 28 8.6 >03_05_0432 - 24231984-24233048,24233391-24235160,24235261-24236582, 24236668-24237013 Length = 1500 Score = 45.2 bits (102), Expect = 5e-05 Identities = 25/88 (28%), Positives = 45/88 (51%) Frame = -1 Query: 566 KEQTETNNCDPTEVDVKQSTSKDLNIEKFKIDEDVNRIEREIIKLNNSLVKYPQGTSGHT 387 +E T + D +D++ + + K+ E + R+E E+ K+ +L+KY + TS T Sbjct: 1399 EEFTSEDGLDGDNIDLRSRHQRKIMERARKMAEKIGRLEVEMQKVQEALLKYEEQTSTRT 1458 Query: 386 NINLQIREKXKELQALKQRERDIIKEQR 303 + + R K + + L R RD K+QR Sbjct: 1459 SKTMHRRSKVQLVDFLYGRRRDSRKQQR 1486 >09_06_0076 + 20710482-20710670,20711313-20711547,20711664-20711689, 20712000-20712293,20712603-20712728,20712827-20712896, 20712992-20713182,20713394-20713519,20713878-20714279, 20714364-20714758,20714861-20715315,20715403-20715524, 20715653-20715693,20716026-20716129,20716363-20716576, 20717667-20717780,20718576-20718612 Length = 1046 Score = 31.1 bits (67), Expect = 0.92 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = -1 Query: 569 DKEQTETNNCDPTEVDVKQSTSKDLNIEKFKIDEDVNRIERE 444 ++++ E CD EVD ++ +D++ EK K E +N + E Sbjct: 445 NEKKIEKEICDDEEVDAEEGKVEDVDEEKEKKGEKINEVSHE 486 >05_07_0329 - 29308867-29308932,29309040-29309159,29309245-29309364, 29309566-29310123,29310199-29310258,29310839-29310904, 29310993-29311103,29311167-29311257,29311349-29311449, 29311534-29311641,29311737-29314205 Length = 1289 Score = 31.1 bits (67), Expect = 0.92 Identities = 19/96 (19%), Positives = 45/96 (46%), Gaps = 1/96 (1%) Frame = -1 Query: 566 KEQTETNNCDPTEVDVKQSTSKDLNIEKFKIDEDVNRIEREIIKLNNSLVKYPQGTSGHT 387 KE+ + E D K+ K + K K+D + ++ + + ++ +L + + Sbjct: 386 KEKEKEKKAAAKEADAKKEEEKAVEAPKGKVD--MKKLPKHVREMQEALARRQEAEERKK 443 Query: 386 NINLQ-IREKXKELQALKQRERDIIKEQRHRKEKEK 282 + +R++ +E ++ ER + +R +KE+EK Sbjct: 444 REEEERLRKEEEERLKKEEEERKAEEAKRRKKEREK 479 >09_04_0087 + 14476539-14476675,14478876-14479635,14479720-14479871, 14479958-14480024,14480632-14480831,14480915-14481068, 14481585-14481669,14481766-14481857,14482575-14482766, 14482867-14482992,14483072-14483125,14483494-14483550, 14484509-14484606,14484703-14485038,14485116-14485203, 14486891-14487016,14487082-14487138,14488054-14488133, 14488228-14488270,14488948-14489034,14489331-14489420, 14489996-14490054,14490141-14490231,14490330-14490495, 14490662-14490755,14491787-14492909 Length = 1537 Score = 30.7 bits (66), Expect = 1.2 Identities = 24/96 (25%), Positives = 48/96 (50%), Gaps = 1/96 (1%) Frame = -1 Query: 566 KEQTETNNCDPTEVDVKQSTSKDLNIEKFKIDEDVNRI-EREIIKLNNSLVKYPQGTSGH 390 +E+TE +N + + D ++ T KD EK +E+ + E+E +L + K + Sbjct: 197 EEETEKDN-EKEKEDKEEETEKDNEKEKEDKEEETKKDNEKEKEQLMGTDEKEKEKEKED 255 Query: 389 TNINLQIREKXKELQALKQRERDIIKEQRHRKEKEK 282 N ++ E+ K+ + K E++ E+ + EK+K Sbjct: 256 ENEEEKLEEEEKKDKEEKLEEKEKENEEENGNEKDK 291 >01_06_1535 + 38057802-38057999,38058338-38058437,38058730-38058890, 38059166-38059363,38059442-38059534,38059732-38059854, 38060637-38060884,38061004-38061175,38061407-38061493, 38061523-38061786,38062415-38062577,38062839-38062926, 38063010-38063079,38063566-38063694,38063773-38063811, 38065539-38065760,38065935-38065999,38066095-38066288, 38066539-38066805,38066908-38066995,38067091-38067216, 38067291-38067400,38067523-38067671 Length = 1117 Score = 30.3 bits (65), Expect = 1.6 Identities = 24/109 (22%), Positives = 53/109 (48%), Gaps = 4/109 (3%) Frame = -1 Query: 587 INRTLGD-KEQTETNNCDPTEVDVKQSTSKDLNIEKFKIDED--VNRIEREIIKLNNSLV 417 +N L D K+Q + + + E++ + L+ E+ D+ + ++ E+ + Sbjct: 237 LNEQLEDLKKQLDESVRENNEMEHRLLNCSSLSYERTPSDDQKLIKLLQEELRNYEKEVD 296 Query: 416 KYPQGTSGHTNINLQIREKXKELQALKQR-ERDIIKEQRHRKEKEKMTI 273 + + S HTN+ L ++EK E Q ++R E ++ K Q + +K+ + Sbjct: 297 EARRLKSSHTNVEL-LKEKILEEQGCRERAEMELSKLQEIEAKAQKLEL 344 >11_06_0634 - 25685216-25685329,25685407-25685511,25685681-25685740, 25685827-25685965,25686056-25686240,25686328-25686411, 25686499-25686621,25687088-25687267,25687364-25687433, 25687520-25687616,25687695-25687770,25688259-25688348, 25688383-25688529,25688647-25688715,25689004-25689177, 25689266-25689336,25689409-25689557,25690723-25690774, 25690865-25691120,25691196-25691287,25691420-25691541, 25691909-25692679,25692883-25692940,25693068-25693107, 25694462-25694595,25694685-25694793,25694896-25694991 Length = 1220 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 Query: 614 SLSRVRKLFCFFLLLSFVTFSIFAAPLN 697 SL +F F+LLLSF IF PLN Sbjct: 151 SLEIALSIFLFYLLLSFTFLQIFQHPLN 178 >10_08_0374 - 17312430-17312513,17312794-17313029,17313081-17313261, 17313335-17313445,17313495-17313722,17313862-17313999, 17314159-17314375,17314452-17314564,17314919-17314921 Length = 436 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/26 (38%), Positives = 20/26 (76%) Frame = -3 Query: 675 EKVTKERRRKKQKSLRTREREREKKC 598 E+ +ER R+K++ + RE+E+E++C Sbjct: 344 EREREEREREKERERQEREQEKEREC 369 >03_05_0371 + 23570246-23570359,23570499-23570575,23570600-23570675, 23570761-23570892,23570945-23571412,23571513-23571590, 23571693-23571809 Length = 353 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/26 (38%), Positives = 20/26 (76%) Frame = -3 Query: 675 EKVTKERRRKKQKSLRTREREREKKC 598 E+ +ER R+K++ + RE+E+E++C Sbjct: 224 EREREEREREKERERQEREQEKEREC 249 >08_02_0672 - 19904353-19904839,19905646-19905704,19906137-19906352, 19906845-19907422,19907506-19908180,19908263-19908653, 19909469-19909621,19909727-19909980,19911023-19911479 Length = 1089 Score = 29.1 bits (62), Expect = 3.7 Identities = 22/99 (22%), Positives = 46/99 (46%), Gaps = 2/99 (2%) Frame = -1 Query: 581 RTLGDKEQTETNNCDPTEVDV--KQSTSKDLNIEKFKIDEDVNRIEREIIKLNNSLVKYP 408 R + + E+ ET + D + K+ KD +E+ + + + R+ R+ K + K Sbjct: 431 RAVNETERIETGSPDKRKERERDKEKRDKDKELERHERERERERVRRDREK--DIKYKEV 488 Query: 407 QGTSGHTNINLQIREKXKELQALKQRERDIIKEQRHRKE 291 + + RE+ KE Q ++ER+ +E+ ++E Sbjct: 489 ERLYKERLKEWEFREREKEYQRQHEKEREKDRERERKRE 527 >03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838, 2353031-2353708,2353800-2353964,2354139-2354433, 2354581-2354795,2354885-2355190,2355269-2355332, 2355426-2355665,2355783-2355886 Length = 1505 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 675 EKVTKERRRKKQKSLRTREREREKKCFQFY 586 EK K RKK++S++ ERER + Q Y Sbjct: 901 EKKKKPEERKKKRSVQEEERERGRVSLQVY 930 >10_01_0126 + 1511963-1512052,1513440-1513785,1513884-1515010 Length = 520 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -3 Query: 678 IEKVTKERR--RKKQKSLRTREREREKKCFQ 592 I+K+ KER +KK+K R +E+ R+KK Q Sbjct: 28 IDKLQKEREMMQKKEKKERKKEKRRQKKAAQ 58 >07_03_0011 + 12370624-12370684,12372573-12372718,12372793-12373129, 12374323-12374452,12375346-12375406,12375572-12375618, 12376873-12376950,12377195-12377345,12377495-12377558, 12377735-12377893,12378007-12378128,12378952-12378981, 12379050-12379124,12379563-12379644,12379809-12379938, 12381417-12382164,12382833-12383054,12383127-12383276, 12384851-12384904,12384985-12385058,12386130-12386204, 12386365-12386584 Length = 1071 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/44 (27%), Positives = 29/44 (65%) Frame = -3 Query: 693 KGAAKIEKVTKERRRKKQKSLRTREREREKKCFQFYQ*DFGG*R 562 K +++++ K+R+R+K +S R +++ +EK+ + ++ GG R Sbjct: 89 KNVEELQQIVKKRKREKTQSDRDKDKGKEKERMEEHERRPGGER 132 >03_06_0422 + 33818887-33819996 Length = 369 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = -3 Query: 663 KERRRKKQKSLRTREREREK 604 +ER R++++ LR RERERE+ Sbjct: 138 RERERRERERLRERERERER 157 >03_01_0192 - 1534013-1535147,1535249-1535370,1535497-1535556, 1535666-1535764,1535839-1535889,1535974-1536175, 1536709-1536911,1537264-1537350,1537435-1537589, 1537640-1537723,1538121-1538325,1538497-1538724 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 4/105 (3%) Frame = -1 Query: 587 INRTLGDKEQTETNNC-DPTEVDVKQSTSKDLNIEKFKIDE---DVNRIEREIIKLNNSL 420 I+ +KE E T VD +S + L ++ +ID ++ I L+ L Sbjct: 246 ISEAQHEKELKELKEITSSTYVDQAKSLQQTLEYKQKQIDSLSTSNTELQNSIKDLDERL 305 Query: 419 VKYPQGTSGHTNINLQIREKXKELQALKQRERDIIKEQRHRKEKE 285 Y Q + I + EL+A ERD+ +E+R + ++ Sbjct: 306 SAYKQSRAEADEIIQSQKSNICELEAQLSEERDLRREERDKAAED 350 >01_06_0213 + 27580635-27581105,27581206-27581298,27581376-27581540, 27581640-27581862,27582329-27582429,27582666-27582713, 27583086-27583172,27583745-27583879,27583985-27584140, 27585336-27585545,27585641-27586351,27586429-27586974, 27587872-27588495,27588595-27588699,27590460-27590711, 27590939-27591766 Length = 1584 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/26 (38%), Positives = 22/26 (84%) Frame = -3 Query: 681 KIEKVTKERRRKKQKSLRTREREREK 604 ++E+ +ERR+++++ LR R+RE+E+ Sbjct: 196 EMERHDRERRKEEERLLRERQREQER 221 >11_02_0022 + 7461902-7462951 Length = 349 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -1 Query: 500 DLNIEKFKIDEDVNRIEREIIKLNNSLVKYPQGTSGH 390 +L + F +DE V + RE+I + L+++ Q GH Sbjct: 308 ELEEKVFVLDEKVGELHRELIGVRMVLLEWSQAARGH 344 >10_01_0030 - 386008-388056,388166-388360,388931-389062,389167-389538, 389753-389894,392274-392533,392737-393015,394796-394939 Length = 1190 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 678 IEKVTKERRRKKQKSLRTREREREKK 601 +E+ KE+R ++++ R R +EREKK Sbjct: 512 LEEEEKEKREEEERRERRRTKEREKK 537 >09_01_0102 + 1582793-1582898,1582988-1583093,1584115-1584172, 1584676-1584745,1585132-1585197,1586374-1586429, 1587992-1588078,1588819-1589139,1589827-1589946, 1590747-1590881,1591529-1591605,1591681-1591756, 1592800-1592874,1592971-1593075,1593299-1593374, 1594482-1594617,1594702-1594804,1595186-1595298, 1596907-1597111,1597173-1597301,1597403-1597517, 1597710-1597795,1599108-1599203,1599615-1599751, 1600374-1600476,1601809-1601888,1602013-1602091, 1602241-1602298,1602489-1602586,1602673-1602767, 1602861-1602918 Length = 1074 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/78 (19%), Positives = 42/78 (53%) Frame = -1 Query: 506 SKDLNIEKFKIDEDVNRIEREIIKLNNSLVKYPQGTSGHTNINLQIREKXKELQALKQRE 327 S+++ + K K+++D+ + I+L V+ GT+ N+N ++++ K++ +++ Sbjct: 314 SREVTMMKEKLEDDIAQAVALKIELEREHVR---GTNVLKNMNNRVKQLQKQIHDFREQY 370 Query: 326 RDIIKEQRHRKEKEKMTI 273 +++ + E +K I Sbjct: 371 IQYTQDESSKAENDKCEI 388 >05_01_0355 - 2774217-2774318,2774608-2774775,2774872-2775090, 2775176-2775319,2775485-2775767,2775874-2775929, 2776012-2776161,2776254-2776340,2776414-2776449, 2777100-2777162,2777247-2777327,2777407-2777496, 2777690-2777767,2777855-2778058,2778139-2778186, 2778262-2778447,2779879-2779978,2780121-2780260 Length = 744 Score = 27.9 bits (59), Expect = 8.6 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 5/78 (6%) Frame = -1 Query: 488 EKFKIDEDVNRIEREIIKLNNSLVKYPQGTSGHTNINLQIREKXKEL-----QALKQRER 324 EK K+ EDV++ R I + + + GH + + E+ + +A+K+R Sbjct: 663 EKKKVVEDVDKDRRYAIDASIVRIMKSRKVMGHQQLVAECVEQLSRMFKPDFKAIKKRIE 722 Query: 323 DIIKEQRHRKEKEKMTIF 270 D+I +EK+ ++ Sbjct: 723 DLITRDYLEREKDNANVY 740 >04_04_1509 - 34074206-34074398,34074506-34074777,34075411-34075608, 34076092-34076187,34076318-34076500,34076597-34076799, 34076887-34077013,34077098-34077292,34077400-34077540, 34077669-34077812,34077876-34078040,34078776-34078976, 34079049-34079195,34079275-34079427,34079731-34079833, 34079954-34080069,34080168-34080349,34080442-34080541, 34081200-34081527,34081605-34081834,34081979-34082110, 34082787-34082859,34083274-34083338 Length = 1248 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 566 KEQTETNNCDPTEVDVKQSTSKDLNIEKFKIDEDVNRIER 447 K + E +C E+D + SK L +E +D+ V R+ER Sbjct: 717 KLEEELKSCKK-ELDASKELSKKLTMENNLLDQKVQRLER 755 >03_01_0373 - 2904914-2904949,2905030-2905144,2906446-2906534, 2906670-2906889,2907921-2907985,2908619-2908879, 2909204-2909417,2910643-2910698,2910891-2910947, 2911043-2911115,2912711-2913225 Length = 566 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 368 REKXKELQALKQRERDIIKEQRHRKEKEK 282 REK KE + ++RER+ +E+R R E+ Sbjct: 121 REKEKEKEKEREREREKDRERRSRSRSER 149 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,796,448 Number of Sequences: 37544 Number of extensions: 189313 Number of successful extensions: 874 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 840 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -