BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0169 (321 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 1.6 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 4.8 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 1.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 7 TFQQNGPEQCKQVTDVLEELLKLPEI 84 T+Q NG E C + ++ L+L E+ Sbjct: 155 TYQSNGEEVCLENCTGYQQYLRLLEV 180 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 20.6 bits (41), Expect = 4.8 Identities = 6/34 (17%), Positives = 19/34 (55%) Frame = +2 Query: 89 RARHNVLFVMPRHFLKFPCNIR*IQCLQLYYLRM 190 R RH+ + + ++ + C I+ ++ + Y +++ Sbjct: 194 RQRHSTIHLSTGNYSRLACEIQFVRSMGYYLIQI 227 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.317 0.131 0.362 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,874 Number of Sequences: 438 Number of extensions: 1208 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6968808 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -