BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0168 (615 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT010005-1|AAQ22474.1| 513|Drosophila melanogaster RE28239p pro... 30 2.9 AE013599-1365|AAF58603.2| 1025|Drosophila melanogaster CG13188-P... 30 2.9 AE013599-1364|AAM68700.2| 513|Drosophila melanogaster CG13188-P... 30 2.9 >BT010005-1|AAQ22474.1| 513|Drosophila melanogaster RE28239p protein. Length = 513 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +3 Query: 417 NKDTNIDIVDAILMPEPNSSLNTNKFVKLWKSKFFITTSVRSLQRYFGKSRGADSIC 587 N++T+I A ++ PN +L + K VKL+ K F + R L+R + R ++ C Sbjct: 148 NEETSIG---AEILKLPNQALESEKIVKLFDMKKFQSNVNRELRRAYPDRRRLETQC 201 >AE013599-1365|AAF58603.2| 1025|Drosophila melanogaster CG13188-PA, isoform A protein. Length = 1025 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +3 Query: 417 NKDTNIDIVDAILMPEPNSSLNTNKFVKLWKSKFFITTSVRSLQRYFGKSRGADSIC 587 N++T+I A ++ PN +L + K VKL+ K F + R L+R + R ++ C Sbjct: 148 NEETSIG---AEILKLPNQALESEKIVKLFDMKKFQSNVNRELRRAYPDRRRLETQC 201 >AE013599-1364|AAM68700.2| 513|Drosophila melanogaster CG13188-PB, isoform B protein. Length = 513 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +3 Query: 417 NKDTNIDIVDAILMPEPNSSLNTNKFVKLWKSKFFITTSVRSLQRYFGKSRGADSIC 587 N++T+I A ++ PN +L + K VKL+ K F + R L+R + R ++ C Sbjct: 148 NEETSIG---AEILKLPNQALESEKIVKLFDMKKFQSNVNRELRRAYPDRRRLETQC 201 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,177,865 Number of Sequences: 53049 Number of extensions: 435203 Number of successful extensions: 1316 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1316 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2517878700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -