BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0168 (615 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125952-5|AAD14697.2| 327|Caenorhabditis elegans Serpentine re... 29 2.6 AC006722-11|AAW88389.1| 327|Caenorhabditis elegans Serpentine r... 29 2.6 Z98853-5|CAB57903.1| 290|Caenorhabditis elegans Hypothetical pr... 29 3.5 U15406-1|AAA50456.1| 2272|Caenorhabditis elegans gag, pol and en... 27 8.1 L23646-13|AAA28035.2| 2175|Caenorhabditis elegans C. elegans RET... 27 8.1 L23646-12|AAL02516.1| 2186|Caenorhabditis elegans C. elegans RET... 27 8.1 >AF125952-5|AAD14697.2| 327|Caenorhabditis elegans Serpentine receptor, class d (delta)protein 61 protein. Length = 327 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -3 Query: 442 TIS-IFVSLFLSILRCKCLHSIEFGLIHLRRHPLVSHLRRLQY 317 TIS ++ ++F SI C CLHS F LI+ R + +LR Y Sbjct: 6 TISRVYWTIFFSI--CLCLHSSMFLLIYYRTSRTIRNLRWFLY 46 >AC006722-11|AAW88389.1| 327|Caenorhabditis elegans Serpentine receptor, class d (delta)protein 75 protein. Length = 327 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -3 Query: 442 TIS-IFVSLFLSILRCKCLHSIEFGLIHLRRHPLVSHLRRLQY 317 TIS ++ ++F SI C CLHS F LI+ R + +LR Y Sbjct: 6 TISRVYWTIFFSI--CLCLHSSMFLLIYYRTSRTIRNLRWFLY 46 >Z98853-5|CAB57903.1| 290|Caenorhabditis elegans Hypothetical protein R08A2.5 protein. Length = 290 Score = 28.7 bits (61), Expect = 3.5 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 4/70 (5%) Frame = -3 Query: 595 LSLQIESAPRDLPKYLCKDLTLV--VIKNLLFQSFTNLLVFRDELGSGIRIASTISIFVS 422 ++ + + PR P K L V + K +L +F ++ ++L SG+ I S S+F S Sbjct: 77 IAQMMNTCPRGFPIQDIKGLWHVTRISKRMLHTTFVDIHEAIEKLSSGLSIGSRKSLF-S 135 Query: 421 LFLS--ILRC 398 LF S ++RC Sbjct: 136 LFKSDPVMRC 145 >U15406-1|AAA50456.1| 2272|Caenorhabditis elegans gag, pol and env protein precursor protein. Length = 2272 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 306 ERCSYCNRRKWLTSGCLRKWIKPNSMECKHLQRS 407 +RCS C +R W C +K S +C Q+S Sbjct: 629 DRCSDCQQRGWHMFWCSKKSKDNASQKCDECQQS 662 >L23646-13|AAA28035.2| 2175|Caenorhabditis elegans C. elegans RETR-1 protein, isoforma protein. Length = 2175 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 306 ERCSYCNRRKWLTSGCLRKWIKPNSMECKHLQRS 407 +RCS C +R W C +K S +C Q+S Sbjct: 532 DRCSDCQQRGWHMFWCSKKSKDNASQKCDECQQS 565 >L23646-12|AAL02516.1| 2186|Caenorhabditis elegans C. elegans RETR-1 protein, isoformb protein. Length = 2186 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 306 ERCSYCNRRKWLTSGCLRKWIKPNSMECKHLQRS 407 +RCS C +R W C +K S +C Q+S Sbjct: 543 DRCSDCQQRGWHMFWCSKKSKDNASQKCDECQQS 576 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,437,114 Number of Sequences: 27780 Number of extensions: 241783 Number of successful extensions: 589 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 589 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1332243108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -