BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0168 (615 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 25 0.59 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 25 0.59 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 24 1.4 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 23 1.8 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 1.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.4 AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced prot... 23 3.1 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 4.1 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 22 5.5 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 9.6 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.0 bits (52), Expect = 0.59 Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +3 Query: 309 RCSYCNRRKWLTSGCLRKWIKPNSMECKHLQRS-IDKNKDTNIDI-VDAILMPE 464 RC YC +K L G R+ ++ K +S ++ + D+ ++ IL E Sbjct: 161 RCQYCRYQKCLAMGMKREAVQEERQRTKERDQSEVESTSSLHSDMPIERILEAE 214 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.0 bits (52), Expect = 0.59 Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +3 Query: 309 RCSYCNRRKWLTSGCLRKWIKPNSMECKHLQRS-IDKNKDTNIDI-VDAILMPE 464 RC YC +K L G R+ ++ K +S ++ + D+ ++ IL E Sbjct: 161 RCQYCRYQKCLAMGMKREAVQEERQRTKERDQSEVESTSSLHSDMPIERILEAE 214 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -3 Query: 502 SFTNLLVFRDELGSGIRIASTISIFVSLFLSIL 404 SF ++LVF SG +++ +ISI +SL + L Sbjct: 251 SFLSVLVFYLPSDSGEKVSLSISILLSLTVFFL 283 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/36 (27%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 309 RCSYCNR---RKWLTSGCLRKWIKPNSMECKHLQRS 407 +C C + R WL G +R C+H R+ Sbjct: 44 KCHLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRA 79 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.4 bits (48), Expect = 1.8 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 502 SFTNLLVFRDELGSGIRIASTISIFVSLFLSIL 404 SF +LVF SG +++ +ISI +SL + L Sbjct: 255 SFLTVLVFYLPSDSGEKVSLSISILLSLTVFFL 287 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +3 Query: 291 MNISYERCSYCNRRKWLTSGCLRKWIK 371 + I+ RC YC +K + G R ++ Sbjct: 113 LRINRNRCQYCRLKKCIAVGMSRDAVR 139 >AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced protein 75 protein. Length = 87 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +3 Query: 291 MNISYERCSYCNRRKWLTSGCLR 359 + I+ RC YC +K + G R Sbjct: 64 LRINRNRCQYCRLKKCIAVGMSR 86 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 423 DTNIDIVDAILMPEPNSSLNTNKF 494 D DI+ I +PEP N K+ Sbjct: 641 DAQFDIIQNIYIPEPQDIENIFKY 664 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 224 KSHKSIYDEKYD 189 KSH IY EKY+ Sbjct: 156 KSHNDIYCEKYE 167 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.0 bits (42), Expect = 9.6 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -3 Query: 535 TLVVIKNLLFQSFTNLLVFRDELGSGIRIASTISIFVSLFLSIL 404 T+ +I + SF +LVF +G ++ ISI +SL + +L Sbjct: 237 TVNLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVVFLL 280 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,027 Number of Sequences: 438 Number of extensions: 3005 Number of successful extensions: 15 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -