BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0166 (732 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_01_0076 + 1105331-1105453,1106559-1106705,1107046-1107195,110... 31 0.71 08_02_1091 + 24256025-24256190,24256806-24257978,24258066-242587... 29 2.9 >09_01_0076 + 1105331-1105453,1106559-1106705,1107046-1107195, 1107272-1107531,1107897-1108084,1108187-1108311, 1108485-1108521,1108802-1108893,1109023-1109133, 1109242-1109352,1109576-1109669,1109833-1109945, 1110316-1110411,1110510-1110617,1110665-1110814, 1110910-1110990,1111205-1111276,1111553-1111646, 1111759-1111787,1111870-1111967,1112065-1112160, 1112399-1112620,1113002-1113158,1113472-1113627, 1113703-1113930 Length = 1045 Score = 31.5 bits (68), Expect = 0.71 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = -2 Query: 695 QVKNKSLTAKTKRKRDLRVIAILSHSLVRA-ETELVMKQRERA 570 QV+ K + K +++ ++ IL HS R ETE +KQRE+A Sbjct: 868 QVREKEMEIKEMKEQMTELVTILRHSESRRRETEKQLKQREQA 910 >08_02_1091 + 24256025-24256190,24256806-24257978,24258066-24258733, 24258994-24260065,24260241-24260563,24260647-24260835, 24261400-24261506,24262103-24262163,24262617-24262634 Length = 1258 Score = 29.5 bits (63), Expect = 2.9 Identities = 16/75 (21%), Positives = 38/75 (50%) Frame = -2 Query: 716 SLSNWVRQVKNKSLTAKTKRKRDLRVIAILSHSLVRAETELVMKQRERARKWAQMQVDLG 537 S+++++ VK K KRD+RV A+ V+ + +RE + A+++ + Sbjct: 1008 SMTSFIPLVKQKQRPTTVCVKRDVRVKALEVAEAVKRREQKKQNEREMRKAAAELERERV 1067 Query: 536 LSNKEEEIARRHREK 492 +E+++ + ++K Sbjct: 1068 KQEREQKLKQMEQKK 1082 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,456,616 Number of Sequences: 37544 Number of extensions: 331721 Number of successful extensions: 987 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 952 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -