BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0164 (652 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyc... 29 0.44 SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe... 29 0.58 SPBC17D11.07c |rpn2||19S proteasome regulatory subunit Rpn2|Schi... 25 9.5 >SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 898 Score = 29.5 bits (63), Expect = 0.44 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 3/100 (3%) Frame = -1 Query: 454 FAAVGLRIESQSVGTYKIVAYTVHAVSESAAIAGVA*FEVSELMGTQFCRLRW---L*RG 284 FA+ GL+ ++ T KI YT+ + AIA S ++ + ++ W L G Sbjct: 323 FASSGLKTNISTLNTGKIWGYTIGTI--CVAIASKM---GSSMLAARILKMPWSDSLVVG 377 Query: 283 SFETRHFVRVLARIYIEIHVGIVTETIGA*FLFSGSIDAF 164 S + + L + I + GI+ ETI + F+F I F Sbjct: 378 SLMSCKGLVELIVLNIGLSTGILNETIFSMFVFMAVITTF 417 >SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 412 Score = 29.1 bits (62), Expect = 0.58 Identities = 18/70 (25%), Positives = 29/70 (41%) Frame = -1 Query: 289 RGSFETRHFVRVLARIYIEIHVGIVTETIGA*FLFSGSIDAFNISVAASGHWIPFVQFPA 110 R + + + + R + + + T+T A F+F D N+ V G F FP Sbjct: 307 RRNLQRTYGEEISQRPFYKTRICYYTDTADAEFVFDYHPDYENLFVCTGGSGHGFKFFPI 366 Query: 109 LSSRPDGCLF 80 L GC+F Sbjct: 367 LGKYSIGCMF 376 >SPBC17D11.07c |rpn2||19S proteasome regulatory subunit Rpn2|Schizosaccharomyces pombe|chr 2|||Manual Length = 965 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 468 SPTAMLKLSSDSVAPKYQ*VENLVPQ 545 SPTA++ L + APK+ + N+ P+ Sbjct: 767 SPTALIGLDKNLNAPKFSFISNVRPK 792 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,938,396 Number of Sequences: 5004 Number of extensions: 66221 Number of successful extensions: 198 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 197 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -