BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0158 (745 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q894B2 Cluster: Trk system potassium uptake protein trk... 33 9.8 >UniRef50_Q894B2 Cluster: Trk system potassium uptake protein trkA; n=6; Clostridium|Rep: Trk system potassium uptake protein trkA - Clostridium tetani Length = 478 Score = 32.7 bits (71), Expect = 9.8 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 6/64 (9%) Frame = +2 Query: 533 YLLK*IPVYIIINYKTLKKDISSSQIILCKERIDLV-----MSLS-VSFSTYTFYLITLM 694 YL+K IP ++ Y +KK ISSS I+ + + +V SL + STY+ ++IT + Sbjct: 317 YLVKLIPSLLLSKYFGIKKAISSSFILSTQLSLIIVGSQIAYSLDLIDSSTYSLFIITTI 376 Query: 695 F*CL 706 CL Sbjct: 377 ISCL 380 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 679,197,857 Number of Sequences: 1657284 Number of extensions: 13381676 Number of successful extensions: 29467 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 28558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29462 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60911752460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -