BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0155 (705 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23D3.08 |usp108||U1 snRNP-associated protein Usp108|Schizosa... 27 2.6 SPBC336.08 |spc24||spindle pole body protein Spc24|Schizosacchar... 27 2.6 SPBC428.07 |meu6||meiotic chromosome segregation protein Meu6|Sc... 26 6.0 >SPAC23D3.08 |usp108||U1 snRNP-associated protein Usp108|Schizosaccharomyces pombe|chr 1|||Manual Length = 382 Score = 27.1 bits (57), Expect = 2.6 Identities = 22/111 (19%), Positives = 47/111 (42%), Gaps = 5/111 (4%) Frame = +1 Query: 364 TLPNTVKI*YPLKNTAICILIQMSQEILIENNNSSIDETITRHHITIGTQT-----SNIL 528 ++P +K+ P K + I ++ LI + I + + ++ T +++L Sbjct: 91 SIPALIKVVTPTKEEDASLNINLAVSSLILGSKVLIHQNLIPSLFSVSNSTKLLYSASLL 150 Query: 529 RLFSTELLLVDDETMQYYTGLETASKFSLVLITFLPMANDIRYRWSRVVGI 681 S L+ ++ + +ET K+ L I+F+P + + Y GI Sbjct: 151 PRSSERLVTLETNEIDASVVIETLLKYILSRISFIPRVSVVPYIPDAAYGI 201 >SPBC336.08 |spc24||spindle pole body protein Spc24|Schizosaccharomyces pombe|chr 2|||Manual Length = 198 Score = 27.1 bits (57), Expect = 2.6 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 297 ETKSREQRLQTRNLKKQLFSLPNTSQHCEDIVPLEEHSNM 416 E S E +LQ +K+QL L EDI EE++NM Sbjct: 100 EIMSLESQLQ--KMKEQLLQLEERENTSEDICQSEENANM 137 >SPBC428.07 |meu6||meiotic chromosome segregation protein Meu6|Schizosaccharomyces pombe|chr 2|||Manual Length = 651 Score = 25.8 bits (54), Expect = 6.0 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +3 Query: 153 SSRLCRKHFVKSDYENISKYTGVKH*-HKYLKKGAVPSIFSWNMKPVSEETKS 308 S+ + V S+ + SK G KH H KKG +F + + ++ TKS Sbjct: 479 STAATNEESVVSNEDRTSKKAGKKHHRHHKKKKGGNKRVFGFKLHKYAKPTKS 531 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,853,577 Number of Sequences: 5004 Number of extensions: 59222 Number of successful extensions: 176 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 176 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -