BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0147 (716 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 23 3.3 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 22 5.7 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 22 5.7 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 21 7.6 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 7.6 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 22.6 bits (46), Expect = 3.3 Identities = 13/51 (25%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = +2 Query: 326 SICEQRHSRLLSLGKFEIKNKNRIIFNRPKLEMLLIYSKTVK--DFFTDFI 472 S C + + KF+ ++K I + E LI+ +T + DF F+ Sbjct: 379 SACTDVEQKFFQVSKFDKRSKLVSILEKAPNERTLIFVETKRNADFLATFL 429 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -2 Query: 286 QTEINQKYTQSVQNYNRLQ 230 Q N +Y Q+ NYN Q Sbjct: 210 QFNFNYQYNQAYSNYNNYQ 228 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -2 Query: 286 QTEINQKYTQSVQNYNRLQ 230 Q N +Y Q+ NYN Q Sbjct: 230 QFNFNYQYNQAYSNYNNYQ 248 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 161 CPTNDRRASQSTAL 202 CP DRR SQS+++ Sbjct: 52 CPVCDRRFSQSSSV 65 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 161 CPTNDRRASQSTAL 202 CP DRR SQS+++ Sbjct: 308 CPVCDRRFSQSSSV 321 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,717 Number of Sequences: 336 Number of extensions: 3150 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -