BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0147 (716 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29537-7|AAO38649.1| 239|Caenorhabditis elegans Egg laying defe... 28 7.7 U29537-6|AAO38648.1| 340|Caenorhabditis elegans Egg laying defe... 28 7.7 U29537-5|AAO38650.1| 414|Caenorhabditis elegans Egg laying defe... 28 7.7 U29537-4|AAO38647.1| 450|Caenorhabditis elegans Egg laying defe... 28 7.7 U29537-3|AAO38646.1| 457|Caenorhabditis elegans Egg laying defe... 28 7.7 U29537-2|AAK31508.1| 465|Caenorhabditis elegans Egg laying defe... 28 7.7 AF283982-1|AAG13397.1| 471|Caenorhabditis elegans transcription... 28 7.7 >U29537-7|AAO38649.1| 239|Caenorhabditis elegans Egg laying defective protein 44,isoform e protein. Length = 239 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -3 Query: 471 MKSVKKSFTVLE*ISNISNFGLLNIIRFLFFISNFP 364 M +V ++FTVL+ ++N LL ++ F+F +S P Sbjct: 186 MNNVLENFTVLQIVTNSETDELLMVLCFVFEVSQEP 221 >U29537-6|AAO38648.1| 340|Caenorhabditis elegans Egg laying defective protein 44,isoform d protein. Length = 340 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -3 Query: 471 MKSVKKSFTVLE*ISNISNFGLLNIIRFLFFISNFP 364 M +V ++FTVL+ ++N LL ++ F+F +S P Sbjct: 287 MNNVLENFTVLQIVTNSETDELLMVLCFVFEVSQEP 322 >U29537-5|AAO38650.1| 414|Caenorhabditis elegans Egg laying defective protein 44,isoform f protein. Length = 414 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -3 Query: 471 MKSVKKSFTVLE*ISNISNFGLLNIIRFLFFISNFP 364 M +V ++FTVL+ ++N LL ++ F+F +S P Sbjct: 361 MNNVLENFTVLQIVTNSETDELLMVLCFVFEVSQEP 396 >U29537-4|AAO38647.1| 450|Caenorhabditis elegans Egg laying defective protein 44,isoform c protein. Length = 450 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -3 Query: 471 MKSVKKSFTVLE*ISNISNFGLLNIIRFLFFISNFP 364 M +V ++FTVL+ ++N LL ++ F+F +S P Sbjct: 397 MNNVLENFTVLQIVTNSETDELLMVLCFVFEVSQEP 432 >U29537-3|AAO38646.1| 457|Caenorhabditis elegans Egg laying defective protein 44,isoform b protein. Length = 457 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -3 Query: 471 MKSVKKSFTVLE*ISNISNFGLLNIIRFLFFISNFP 364 M +V ++FTVL+ ++N LL ++ F+F +S P Sbjct: 404 MNNVLENFTVLQIVTNSETDELLMVLCFVFEVSQEP 439 >U29537-2|AAK31508.1| 465|Caenorhabditis elegans Egg laying defective protein 44,isoform a protein. Length = 465 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -3 Query: 471 MKSVKKSFTVLE*ISNISNFGLLNIIRFLFFISNFP 364 M +V ++FTVL+ ++N LL ++ F+F +S P Sbjct: 412 MNNVLENFTVLQIVTNSETDELLMVLCFVFEVSQEP 447 >AF283982-1|AAG13397.1| 471|Caenorhabditis elegans transcription enhancer factor-1-like protein EGL-44 protein. Length = 471 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -3 Query: 471 MKSVKKSFTVLE*ISNISNFGLLNIIRFLFFISNFP 364 M +V ++FTVL+ ++N LL ++ F+F +S P Sbjct: 418 MNNVLENFTVLQIVTNSETDELLMVLCFVFEVSQEP 453 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,175,097 Number of Sequences: 27780 Number of extensions: 274457 Number of successful extensions: 690 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 690 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -