BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0146 (705 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC053325-1|AAH53325.1| 702|Homo sapiens chromosome 14 open read... 31 3.0 AK023213-1|BAB14466.1| 702|Homo sapiens protein ( Homo sapiens ... 31 3.0 AK001673-1|BAA91826.1| 702|Homo sapiens protein ( Homo sapiens ... 31 3.0 BX004861-1|CAI41713.1| 528|Homo sapiens chromosome X open readi... 31 4.0 BC101576-1|AAI01577.1| 528|Homo sapiens chromosome X open readi... 31 4.0 BC101572-1|AAI01573.1| 528|Homo sapiens gamma-taxilin protein. 31 4.0 AY739713-1|AAW65982.1| 396|Homo sapiens CXORF15 protein. 31 4.0 AL929302-1|CAI41279.1| 528|Homo sapiens chromosome X open readi... 31 4.0 AK002071-1|BAA92068.1| 528|Homo sapiens protein ( Homo sapiens ... 31 4.0 AK092895-1|BAC03998.1| 167|Homo sapiens idase mRNA. protein. 31 5.3 BC112926-1|AAI12927.1| 1306|Homo sapiens ARHGEF10 protein protein. 30 9.3 AF009205-1|AAB71662.1| 988|Homo sapiens unknown protein. 30 9.3 AB002292-1|BAA20754.2| 1405|Homo sapiens KIAA0294 protein. 30 9.3 >BC053325-1|AAH53325.1| 702|Homo sapiens chromosome 14 open reading frame 115 protein. Length = 702 Score = 31.5 bits (68), Expect = 3.0 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -2 Query: 341 WKTR-RLFARKPTVAQSSPAPRYRPRIWLNAPSKFWMWPATAAAGPQ 204 W+ R R AR+ ++ P R+R R +PS FW+W + A P+ Sbjct: 507 WQRRLRRAARRQVLSGHLPFCRFRLRYPSLSPSAFWVWKSLARGWPR 553 >AK023213-1|BAB14466.1| 702|Homo sapiens protein ( Homo sapiens cDNA FLJ13151 fis, clone NT2RP3003377. ). Length = 702 Score = 31.5 bits (68), Expect = 3.0 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -2 Query: 341 WKTR-RLFARKPTVAQSSPAPRYRPRIWLNAPSKFWMWPATAAAGPQ 204 W+ R R AR+ ++ P R+R R +PS FW+W + A P+ Sbjct: 507 WQRRLRRAARRQVLSGHLPFCRFRLRYPSLSPSAFWVWKSLARGWPR 553 >AK001673-1|BAA91826.1| 702|Homo sapiens protein ( Homo sapiens cDNA FLJ10811 fis, clone NT2RP4000955. ). Length = 702 Score = 31.5 bits (68), Expect = 3.0 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -2 Query: 341 WKTR-RLFARKPTVAQSSPAPRYRPRIWLNAPSKFWMWPATAAAGPQ 204 W+ R R AR+ ++ P R+R R +PS FW+W + A P+ Sbjct: 507 WQRRLRRAARRQVLSGHLPFCRFRLRYPSLSPSAFWVWKSLARGWPR 553 >BX004861-1|CAI41713.1| 528|Homo sapiens chromosome X open reading frame 15 protein. Length = 528 Score = 31.1 bits (67), Expect = 4.0 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +3 Query: 24 LTRKQQRSCISSTIHTQTFQETSVKACRLLRSICRIQQRHYSSLYPWRLQSLK 182 + +K+Q + +H Q+ ++ A L S+CR QRH +L +Q + Sbjct: 179 ILQKKQAQIVKEKVHLQSEHSKAILARSKLESLCRELQRHNKTLKEENMQQAR 231 >BC101576-1|AAI01577.1| 528|Homo sapiens chromosome X open reading frame 15 protein. Length = 528 Score = 31.1 bits (67), Expect = 4.0 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +3 Query: 24 LTRKQQRSCISSTIHTQTFQETSVKACRLLRSICRIQQRHYSSLYPWRLQSLK 182 + +K+Q + +H Q+ ++ A L S+CR QRH +L +Q + Sbjct: 179 ILQKKQAQIVKEKVHLQSEHSKAILARSKLESLCRELQRHNKTLKEENMQQAR 231 >BC101572-1|AAI01573.1| 528|Homo sapiens gamma-taxilin protein. Length = 528 Score = 31.1 bits (67), Expect = 4.0 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +3 Query: 24 LTRKQQRSCISSTIHTQTFQETSVKACRLLRSICRIQQRHYSSLYPWRLQSLK 182 + +K+Q + +H Q+ ++ A L S+CR QRH +L +Q + Sbjct: 179 ILQKKQAQIVKEKVHLQSEHSKAILARSKLESLCRELQRHNKTLKEENMQQAR 231 >AY739713-1|AAW65982.1| 396|Homo sapiens CXORF15 protein. Length = 396 Score = 31.1 bits (67), Expect = 4.0 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +3 Query: 24 LTRKQQRSCISSTIHTQTFQETSVKACRLLRSICRIQQRHYSSLYPWRLQSLK 182 + +K+Q + +H Q+ ++ A L S+CR QRH +L +Q + Sbjct: 47 ILQKKQAQIVKEKVHLQSEHSKAILARSKLESLCRELQRHNKTLKEENMQQAR 99 >AL929302-1|CAI41279.1| 528|Homo sapiens chromosome X open reading frame 15 protein. Length = 528 Score = 31.1 bits (67), Expect = 4.0 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +3 Query: 24 LTRKQQRSCISSTIHTQTFQETSVKACRLLRSICRIQQRHYSSLYPWRLQSLK 182 + +K+Q + +H Q+ ++ A L S+CR QRH +L +Q + Sbjct: 179 ILQKKQAQIVKEKVHLQSEHSKAILARSKLESLCRELQRHNKTLKEENMQQAR 231 >AK002071-1|BAA92068.1| 528|Homo sapiens protein ( Homo sapiens cDNA FLJ11209 fis, clone PLACE1007946. ). Length = 528 Score = 31.1 bits (67), Expect = 4.0 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +3 Query: 24 LTRKQQRSCISSTIHTQTFQETSVKACRLLRSICRIQQRHYSSLYPWRLQSLK 182 + +K+Q + +H Q+ ++ A L S+CR QRH +L +Q + Sbjct: 179 ILQKKQAQIVKEKVHLQSEHSKAILARSKLESLCRELQRHNKTLKEENMQQAR 231 >AK092895-1|BAC03998.1| 167|Homo sapiens idase mRNA. protein. Length = 167 Score = 30.7 bits (66), Expect = 5.3 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -2 Query: 311 PTVAQSSPAPRYRPRIWLNAPSKFWMWPATAAAGPQV 201 P + S APR W P + +WPA AAGPQ+ Sbjct: 103 PRLRPSHTAPRPLTAGWAGVPGEA-LWPARLAAGPQL 138 >BC112926-1|AAI12927.1| 1306|Homo sapiens ARHGEF10 protein protein. Length = 1306 Score = 29.9 bits (64), Expect = 9.3 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -3 Query: 385 AFTNANTLKLIDTVNGRHVVSLLVSRPWRNLLP 287 AFT+ +TL+L T +H+ + ++ P N+LP Sbjct: 1062 AFTSGSTLRLFHTETLKHLQDINIATPVHNMLP 1094 >AF009205-1|AAB71662.1| 988|Homo sapiens unknown protein. Length = 988 Score = 29.9 bits (64), Expect = 9.3 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -3 Query: 385 AFTNANTLKLIDTVNGRHVVSLLVSRPWRNLLP 287 AFT+ +TL+L T +H+ + ++ P N+LP Sbjct: 744 AFTSGSTLRLFHTETLKHLQDINIATPVHNMLP 776 >AB002292-1|BAA20754.2| 1405|Homo sapiens KIAA0294 protein. Length = 1405 Score = 29.9 bits (64), Expect = 9.3 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -3 Query: 385 AFTNANTLKLIDTVNGRHVVSLLVSRPWRNLLP 287 AFT+ +TL+L T +H+ + ++ P N+LP Sbjct: 1161 AFTSGSTLRLFHTETLKHLQDINIATPVHNMLP 1193 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,138,466 Number of Sequences: 237096 Number of extensions: 2278361 Number of successful extensions: 4719 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 4498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4719 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8175213644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -