BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0146 (705 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016445-3|AAC69063.2| 372|Caenorhabditis elegans Serpentine re... 28 7.5 U53141-7|AAA96109.1| 82|Caenorhabditis elegans Hypothetical pr... 27 9.9 U00066-9|AAA50743.3| 780|Caenorhabditis elegans Mediator protei... 27 9.9 U00066-8|AAM54164.1| 777|Caenorhabditis elegans Mediator protei... 27 9.9 >AF016445-3|AAC69063.2| 372|Caenorhabditis elegans Serpentine receptor, class w protein133 protein. Length = 372 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = -2 Query: 662 FFFMLVYLAIEGSGLQCH*GYREYIFTITLSFNVKKIFVL 543 F + + ++ GLQ Y +Y+F++ L+ N FV+ Sbjct: 290 FSMAVTWFFVDVPGLQLIFSYSQYLFSVVLTINTSSHFVI 329 >U53141-7|AAA96109.1| 82|Caenorhabditis elegans Hypothetical protein C14C11.7 protein. Length = 82 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 320 ARKPTVAQSSPAPRYRPRIWLNAP 249 A P AQ +PAP +P+ +++AP Sbjct: 42 APPPPAAQQAPAPAEQPKFYISAP 65 >U00066-9|AAA50743.3| 780|Caenorhabditis elegans Mediator protein 15, isoform a protein. Length = 780 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = +2 Query: 200 KLEVLLQQLQA---TSKTYLEHLAIFLAGNEEREKIAPRS 310 KLEV+L L+ S YL HL +++A ++ IAP S Sbjct: 403 KLEVMLSVLEGKRVVSLEYLNHLEMWIARKQDFLNIAPMS 442 >U00066-8|AAM54164.1| 777|Caenorhabditis elegans Mediator protein 15, isoform b protein. Length = 777 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = +2 Query: 200 KLEVLLQQLQA---TSKTYLEHLAIFLAGNEEREKIAPRS 310 KLEV+L L+ S YL HL +++A ++ IAP S Sbjct: 400 KLEVMLSVLEGKRVVSLEYLNHLEMWIARKQDFLNIAPMS 439 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,740,064 Number of Sequences: 27780 Number of extensions: 364675 Number of successful extensions: 989 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 988 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -