BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0143 (432 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 27 0.12 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 1.1 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 2.6 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 5.9 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 26.6 bits (56), Expect = 0.12 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 337 LPQPKMANTDLTRLLKSDEIRKVLRAPNKRV 429 LP P N L L+ S E+R+ +APN V Sbjct: 490 LPPPYRLNKPLMSLITSSEVRQPGKAPNYSV 520 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.4 bits (48), Expect = 1.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 235 HLGRFVIWTQSAFGRLDPLFGSWKTPSKQKKNFNLP 342 H + WT ++ P G +KT SK F+LP Sbjct: 25 HRPAWWFWTATSHEASAPAEGKFKTVSKVPGPFSLP 60 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 2.6 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 269 HSAGLTPYSGHGRHHQNKRRTSTCPNRRWPTLTSHVFSSLMRS 397 H+ G T H HH + R+ PTL S +SS + S Sbjct: 341 HTMGPTMGPPHHHHHHQTQSLQHLHYRQPPTL-SESYSSYVNS 382 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.0 bits (42), Expect = 5.9 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +2 Query: 290 YSGHGRHHQNKRRTSTC 340 YS + HH R S+C Sbjct: 435 YSAYSLHHVRSSRESSC 451 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,950 Number of Sequences: 438 Number of extensions: 1815 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11244597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -