BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0142 (584 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 4.4 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 5.8 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 7.7 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 7.7 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -2 Query: 460 TLKRIIYRNLKNY 422 TLK +YRN+KN+ Sbjct: 566 TLKIGVYRNIKNF 578 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +2 Query: 422 IILEVTVNNSFQCIYLSKFICC 487 ++ ++ +SF+CI+LS C Sbjct: 73 VVEKILTQSSFECIHLSVLHKC 94 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 99 PTRADSQEVLPPVFYNNIISVNTQMFLT*TK 191 P + +++L P F+ NI+ Q+F TK Sbjct: 121 PKWQNRRKILTPAFHFNILQEFIQIFNEETK 151 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 99 PTRADSQEVLPPVFYNNIISVNTQMFLT*TK 191 P + +++L P F+ NI+ Q+F TK Sbjct: 121 PKWQNRRKILTPAFHFNILQEFIQIFNEETK 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,595 Number of Sequences: 336 Number of extensions: 2750 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14621740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -