BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0142 (584 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 2.9 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 3.9 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/35 (28%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 571 LGGIGIVNLSIPFSSDVLPSQRK-SLYIFTADEFR 470 +GGIG++ + + + + Q+K L AD++R Sbjct: 835 IGGIGLIIIEVAYKKHQIRKQKKMELARHAADKWR 869 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 22.2 bits (45), Expect = 3.9 Identities = 7/18 (38%), Positives = 8/18 (44%) Frame = -1 Query: 269 NFDIIQCCSSFFFWSLWP 216 N DI + F W WP Sbjct: 208 NSDIFAMIGTIFLWLFWP 225 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,190 Number of Sequences: 438 Number of extensions: 2922 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -