BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0137 (686 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0414 + 9972157-9972257,9972925-9973003,9973657-9973755,997... 29 3.5 >02_02_0414 + 9972157-9972257,9972925-9973003,9973657-9973755, 9973848-9973913,9974225-9974376,9974503-9974584, 9974696-9974781,9974919-9975098,9975320-9975717, 9976192-9976790,9977141-9977239 Length = 646 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 282 KIYSNIYKILFSSVIYFSDFCTKVIYHPYVY 374 K+YSN+ LF+ VI+ S F + H ++ Sbjct: 614 KVYSNLKAFLFTPVIFLSSFSAMSVVHISIF 644 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,566,420 Number of Sequences: 37544 Number of extensions: 248693 Number of successful extensions: 397 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -