BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0137 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42379| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_35310| Best HMM Match : Cadherin (HMM E-Value=5.9e-23) 28 8.1 >SB_42379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +3 Query: 129 VLNFNTFVNSSMFIINIKILNYQNDCLYLDGRGFVI 236 ++ F+N + +IN K+L ++ CL ++G V+ Sbjct: 134 IVPLKVFINPKLRVINPKMLAFRESCLSVEGHSAVV 169 >SB_35310| Best HMM Match : Cadherin (HMM E-Value=5.9e-23) Length = 1250 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 102 DTVTFSFSCVLNFNTFVNSSMFIINIKILNYQNDCLYLDG 221 D TF+F+ NF+ V + F I +K +N +YL+G Sbjct: 487 DKSTFTFTASANFSKGVVTREFTITVKNVNEAPTDIYLNG 526 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,402,138 Number of Sequences: 59808 Number of extensions: 348904 Number of successful extensions: 666 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -