BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0136 (682 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 6.2 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 8.2 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 8.2 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 8.2 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 8.2 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 330 KASTRNTGASRP*TKLSTDLTSE 398 K+S +TG+S P LST L S+ Sbjct: 357 KSSESSTGSSIPKLNLSTALMSQ 379 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = -2 Query: 147 SPQGSRVSRWSPSGIGVLTNFLQ 79 +PQG +S + P G+ +L + ++ Sbjct: 361 TPQGVFLSLYQPQGMNILGDLIE 383 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 8.2 Identities = 5/14 (35%), Positives = 9/14 (64%) Frame = -2 Query: 276 WFAASVVSFTLLIW 235 W +S +SF ++W Sbjct: 171 WICSSAISFPAIVW 184 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 35 DASGLSYEQWMRLENCKKFVKTPMPDGLHL 124 DA +S +QW F P DG+ L Sbjct: 327 DAKTISVQQWNSYWGILGFPSAPTIDGIFL 356 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 35 DASGLSYEQWMRLENCKKFVKTPMPDGLHL 124 DA +S +QW F P DG+ L Sbjct: 327 DAKTISVQQWNSYWGILGFPSAPTIDGIFL 356 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,890 Number of Sequences: 438 Number of extensions: 4150 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -