BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0135 (723 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0580 + 4624111-4624549,4625243-4625955 29 3.7 03_02_0191 - 6270591-6271364,6271458-6272168 29 3.7 01_01_0078 + 587975-588179,588506-588606,589087-589167,589240-59... 29 3.7 07_01_0310 + 2209084-2209554 28 8.6 >11_01_0580 + 4624111-4624549,4625243-4625955 Length = 383 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 209 RPWKNGGCVIFMGC 250 RPWKN V+FMGC Sbjct: 281 RPWKNHSRVVFMGC 294 >03_02_0191 - 6270591-6271364,6271458-6272168 Length = 494 Score = 29.1 bits (62), Expect = 3.7 Identities = 21/73 (28%), Positives = 32/73 (43%) Frame = -3 Query: 547 IPHFPTVPAERAAVGQLLFSLNRALSSGTATLPPLPLPQRDILIISSKTMTLAPTR*TMC 368 IP P++ A RA ++FS L T P DIL+++ + P+ M Sbjct: 147 IPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPK----DIDILVVNCSLFSPTPSLSAMI 202 Query: 367 LSNVKANSTFRSF 329 ++ K S RSF Sbjct: 203 INKYKLRSNIRSF 215 >01_01_0078 + 587975-588179,588506-588606,589087-589167,589240-590178, 590388-590542,590837-590902,590963-591023,591659-591853, 591939-592049,592116-592280 Length = 692 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -3 Query: 514 AAVGQLLFSLNRALSSGTATLPPLPLPQRDILIISSKTMTLAP 386 A+ GQLL + LSS + PL + +D + SKT + P Sbjct: 373 ASSGQLLQNAPSMLSSSQSMQTPLQMSSKDFKAVESKTRVVEP 415 >07_01_0310 + 2209084-2209554 Length = 156 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -3 Query: 556 KLVIPHFPTVPAERAAVGQLLFSLNRALSSGTATLPPLP 440 K+ +P P VPA L + + TATLPP+P Sbjct: 66 KVALPPMPAVPAVPTVPAVALPPMPAVPAVPTATLPPMP 104 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,498,296 Number of Sequences: 37544 Number of extensions: 318407 Number of successful extensions: 751 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 751 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -