BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0134 (749 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 29 0.062 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 22 5.3 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 5.3 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 7.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 7.1 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 22 7.1 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 9.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 9.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 9.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.3 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 28.7 bits (61), Expect = 0.062 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +1 Query: 415 EMSRRSVKEPRKIPDSSSRDHGVQPSIHRGHDFSIR*VPTDGSAA 549 E ++K ++ P+SSS D SIH+ FS+ TDG A Sbjct: 92 ESDNENIKSQKEFPNSSSSDDERPNSIHQRASFSLN---TDGDIA 133 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 22.2 bits (45), Expect = 5.3 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = +2 Query: 227 EMDEAFKKAQKPWSKLLQKVERARLEYHTACKQERTAQNQERNASGDS 370 E+ + KKA++ +++QK LE +T +NQ D+ Sbjct: 162 EIQKXIKKAKEDVIEVIQKAHNMELEPTPGNTLRQTFENQVNRILNDA 209 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 5.3 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 288 NAPG*STTRLANKKEQRRIRKETPAETALLVQIK 389 N G S + AN K+Q + P +T L QIK Sbjct: 993 NQAGKSILQTANIKQQSPQQHVLPGKTLLASQIK 1026 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 159 ITSFTSLSLTLRWRSESRSASTM 91 +TS TS S+ L W+S +++ Sbjct: 1412 VTSSTSSSILLHWKSGHNGGASL 1434 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 159 ITSFTSLSLTLRWRSESRSASTM 91 +TS TS S+ L W+S +++ Sbjct: 1408 VTSSTSSSILLHWKSGHNGGASL 1430 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 617 LPQIYEEFHHTINNADSQKDLK 682 + QI E HH +N +DLK Sbjct: 15 IQQILESVHHCHHNGVVHRDLK 36 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = +2 Query: 539 EAQRLKFFKDVLFSFHKCLNISQEPSLPQ 625 E ++ ++KD++ K L + P LP+ Sbjct: 335 EEEKADWWKDIMLLNEKTLAVPAPPVLPE 363 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = +2 Query: 539 EAQRLKFFKDVLFSFHKCLNISQEPSLPQ 625 E ++ ++KD++ K L + P LP+ Sbjct: 335 EEEKADWWKDIMLLNEKTLAVPAPPVLPE 363 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = +2 Query: 539 EAQRLKFFKDVLFSFHKCLNISQEPSLPQ 625 E ++ ++KD++ K L + P LP+ Sbjct: 335 EEEKADWWKDIMLLNEKTLAVPAPPVLPE 363 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 9.3 Identities = 6/31 (19%), Positives = 17/31 (54%) Frame = +2 Query: 302 EYHTACKQERTAQNQERNASGDSSFSPDQVK 394 ++H +Q++ Q +++ + PD++K Sbjct: 158 DHHRPYQQQQQQQQRQQQRQEERRLRPDEIK 188 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,865 Number of Sequences: 438 Number of extensions: 4945 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -