BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0133 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29857| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_17078| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_29857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1264 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 183 TLIICDRESCKVFKTSQIIYTQFKKSEIKSLQFNYDRIG 67 T+ + DR +C + KT Q+ F +NY R+G Sbjct: 299 TMCVYDRRACSLLKTIQLASPAFSMCHSLRTGYNYLRVG 337 >SB_17078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 380 PWDCRRPLATVITHHQTVCSSAYTD 454 P DCRR +A+V+ ++ + SS Y D Sbjct: 165 PMDCRRKMASVVRNYILIGSSHYYD 189 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,793,144 Number of Sequences: 59808 Number of extensions: 304399 Number of successful extensions: 891 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 887 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -