BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0131 (640 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_55804| Best HMM Match : Acyl_transf_1 (HMM E-Value=1.2e-07) 29 2.4 SB_15448| Best HMM Match : Utp11 (HMM E-Value=0.89) 29 4.2 SB_22519| Best HMM Match : Pterin_4a (HMM E-Value=0.86) 27 9.7 >SB_20108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 29.5 bits (63), Expect = 2.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 557 PVIYLRCRSEEFCDCQWNTKS 495 PV+Y+RC ++C W+ KS Sbjct: 359 PVLYIRCEDPKYCPVLWHYKS 379 >SB_55804| Best HMM Match : Acyl_transf_1 (HMM E-Value=1.2e-07) Length = 1306 Score = 29.5 bits (63), Expect = 2.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 557 PVIYLRCRSEEFCDCQWNTKS 495 PV+Y+RC ++C W+ KS Sbjct: 1128 PVLYIRCEDPKYCPVLWHYKS 1148 >SB_15448| Best HMM Match : Utp11 (HMM E-Value=0.89) Length = 1328 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +1 Query: 385 QNAYKEWLDLTY--I*VDYYQSRQSDFWTMIGKSEKRIID 498 QN YKEW++ + I D +S ++W + K EK++ + Sbjct: 725 QNKYKEWMEGPWGTIDPDKVESETGNYWRSLYKLEKQLTE 764 >SB_22519| Best HMM Match : Pterin_4a (HMM E-Value=0.86) Length = 1578 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = +2 Query: 128 VMGYAKAGSIPSLGAGIIFGSILGVGAYQLSQDPSNY 238 V GY G IP++G+ ++GSI GV A +Q PS Y Sbjct: 586 VNGYG--GPIPNIGSFAMYGSIDGVAA---AQFPSGY 617 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,422,826 Number of Sequences: 59808 Number of extensions: 288705 Number of successful extensions: 419 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -