BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0131 (640 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF040655-1|AAK84577.2| 678|Caenorhabditis elegans Hypothetical ... 29 3.7 Z54342-5|CAA91147.1| 457|Caenorhabditis elegans Hypothetical pr... 27 8.6 >AF040655-1|AAK84577.2| 678|Caenorhabditis elegans Hypothetical protein T24E12.5 protein. Length = 678 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 74 MGLDIIGFAYAATVAAGGVMGYAKAGSIPSLGAGIIFGSILGVGA 208 +GL A +A GV+ + AG+ + AG++ S GVGA Sbjct: 21 VGLSAASATGAGVASAAGVVAASAAGTGAASTAGVVAASAAGVGA 65 >Z54342-5|CAA91147.1| 457|Caenorhabditis elegans Hypothetical protein C08H9.10 protein. Length = 457 Score = 27.5 bits (58), Expect = 8.6 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = +2 Query: 284 YRYYNSRKFMPAGLMFCLSVGMFTKLLLKNVGASRMPIKSG*T*LIYESTIIKAGNLTFG 463 ++Y F PA L VG F + +N +R ++ T +IY I K GN+TFG Sbjct: 94 FKYSTETIFPPAALCGKRIVGYFAEF--ENTALTRKQLQML-THIIYLFAIPKNGNMTFG 150 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,465,775 Number of Sequences: 27780 Number of extensions: 229500 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -