BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0130 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07400.1 68414.m00789 17.8 kDa class I heat shock protein (HS... 36 0.026 At4g27670.1 68417.m03979 25.3 kDa small heat shock protein, chlo... 35 0.045 At1g35515.1 68414.m04409 myb family transcription factor (MYB8) ... 30 1.3 At2g20950.4 68415.m02474 expressed protein 29 3.0 At2g20950.3 68415.m02473 expressed protein 29 3.0 At2g20950.2 68415.m02472 expressed protein 29 3.0 At2g20950.1 68415.m02471 expressed protein 29 3.0 At1g55970.1 68414.m06419 histone acetyltransferase 4 (HAC4) simi... 29 3.9 At5g54110.1 68418.m06737 vesicle-associated membrane family prot... 28 5.2 At5g45270.1 68418.m05556 WRKY family transcription factor contai... 28 5.2 At5g02290.2 68418.m00153 protein kinase, putative similar to pro... 28 6.9 At5g02290.1 68418.m00152 protein kinase, putative similar to pro... 28 6.9 At1g59750.2 68414.m06728 auxin-responsive factor (ARF1) identica... 28 6.9 At1g59750.1 68414.m06727 auxin-responsive factor (ARF1) identica... 28 6.9 At3g61415.1 68416.m06878 SKP1 family protein low similarity to S... 27 9.1 >At1g07400.1 68414.m00789 17.8 kDa class I heat shock protein (HSP17.8-CI) similar to 17.5 kDa class I heat shock protein SP:P04793 from [Glycine max]; contains Pfam PF00011: Hsp20/alpha crystallin family Length = 157 Score = 35.9 bits (79), Expect = 0.026 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 9/77 (11%) Frame = +1 Query: 289 DVSQYTPEEIVVKTVDNKLLV-----HAKHEEKSDT-KSVYR---EYNREFLLPKGTNPE 441 D+ EE+ V+ D+ +L H + EEK DT V R +++R+F LP+ + Sbjct: 64 DLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVERSSGQFSRKFKLPENVKMD 123 Query: 442 AIKSSLSRDGVLTVEAP 492 +K+S+ +GVLTV P Sbjct: 124 QVKASM-ENGVLTVTVP 139 >At4g27670.1 68417.m03979 25.3 kDa small heat shock protein, chloroplast precursor (HSP25.3-P) identical to small heat shock protein, chloroplast precursor SP:P31170 from [Arabidopsis thaliana]; identified in Scharf, K-D., et al,Cell Stress & Chaperones (2001) 6: 225-237. Length = 227 Score = 35.1 bits (77), Expect = 0.045 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 4/77 (5%) Frame = +1 Query: 274 LKLRFDVSQYTPEEIVVKTVDNKLLV--HAKHEEKSDTKS--VYREYNREFLLPKGTNPE 441 +K+RFD+ + E++ + DN L++ K E+ D+ S Y LP + Sbjct: 138 IKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKD 197 Query: 442 AIKSSLSRDGVLTVEAP 492 IK+ L ++GVL + P Sbjct: 198 KIKAEL-KNGVLFITIP 213 >At1g35515.1 68414.m04409 myb family transcription factor (MYB8) similar to DNA-binding protein GB:AAA98761 GI:1020155 from [Arabidopsis thaliana] Length = 212 Score = 30.3 bits (65), Expect = 1.3 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Frame = +2 Query: 341 NYWSMPNTRRNLIRNLCTENTTGSFCCPREQILRP----LSLRCPGTVCLPWKRHCHNSP 508 NYW+ + +R L+ T GS P+ P L PG+V L + C N Sbjct: 106 NYWNT-HIKRKLLNRGIDPKTHGSIIEPKTTSFHPRNEDLKSTFPGSVKLKMETSCENCA 164 Query: 509 SRTGT 523 S +GT Sbjct: 165 STSGT 169 >At2g20950.4 68415.m02474 expressed protein Length = 530 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 7 ESARGWRFFGYRYRISSIRERFDAEMRKMEEEMSKFRSELMNRE 138 E A ++G +RE D EM ++EM + R EL RE Sbjct: 438 ELAEAVEYYGKYDTAKIVREECDREMTAGKKEMEEMREELRRRE 481 >At2g20950.3 68415.m02473 expressed protein Length = 505 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 7 ESARGWRFFGYRYRISSIRERFDAEMRKMEEEMSKFRSELMNRE 138 E A ++G +RE D EM ++EM + R EL RE Sbjct: 413 ELAEAVEYYGKYDTAKIVREECDREMTAGKKEMEEMREELRRRE 456 >At2g20950.2 68415.m02472 expressed protein Length = 503 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 7 ESARGWRFFGYRYRISSIRERFDAEMRKMEEEMSKFRSELMNRE 138 E A ++G +RE D EM ++EM + R EL RE Sbjct: 411 ELAEAVEYYGKYDTAKIVREECDREMTAGKKEMEEMREELRRRE 454 >At2g20950.1 68415.m02471 expressed protein Length = 520 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 7 ESARGWRFFGYRYRISSIRERFDAEMRKMEEEMSKFRSELMNRE 138 E A ++G +RE D EM ++EM + R EL RE Sbjct: 428 ELAEAVEYYGKYDTAKIVREECDREMTAGKKEMEEMREELRRRE 471 >At1g55970.1 68414.m06419 histone acetyltransferase 4 (HAC4) similar to CREB-binding protein GB:AAC51770 GI:2443859 from [Homo sapiens]; contains Pfam PF02135: TAZ zinc finger profile; contains Pfam PF00569: Zinc finger, ZZ type domain; identical to histone acetyltransferase HAC4 (GI:14794966) {Arabidopsis thaliana} Length = 1456 Score = 28.7 bits (61), Expect = 3.9 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 260 VTARLSSFALMSASILPKRSLLR-LSTTNYWSMPNTRRNL 376 VT+ S+ M + LPKR L L TN+ S PN R NL Sbjct: 315 VTSYHSNLQPMQQTPLPKRQLHHPLWNTNFQSAPNNRDNL 354 >At5g54110.1 68418.m06737 vesicle-associated membrane family protein / VAMP family protein similar to VAP27 GI:6688926 [Nicotiana plumbaginifolia] Length = 266 Score = 28.3 bits (60), Expect = 5.2 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Frame = +2 Query: 290 MSASILPKRSLLRLSTTNYWSMPNTRRNLIRN-LCTENTTGSFCCPREQILRPLS--LRC 460 ++ S+LP R LRL ++Y P +R+ + +NT+ S + Q P S +R Sbjct: 66 VARSLLPARRRLRLDPSSYLYFPYEPGKQVRSAIKLKNTSKSHTAFKFQTTAPKSCYMRP 125 Query: 461 PGTVCLP 481 PG V P Sbjct: 126 PGGVLAP 132 >At5g45270.1 68418.m05556 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 114 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 516 VRDGELWQWRFHGKHTVPGQRRLNGLRICS 427 + +G+LW WR +G+ + G R G C+ Sbjct: 31 IDEGDLWTWRKYGQKDILGSRFPRGYYRCA 60 >At5g02290.2 68418.m00153 protein kinase, putative similar to protein kinase APK1A [Arabidopsis thaliana] SWISS-PROT:Q06548 Length = 389 Score = 27.9 bits (59), Expect = 6.9 Identities = 24/103 (23%), Positives = 44/103 (42%), Gaps = 3/103 (2%) Frame = +2 Query: 248 FKTRVTARLSSFALMSASILPKRSLLRLSTTNYWSMPNTRRNLIRNLCTENTTGSFCCPR 427 F R+ ++S +S+ L + ST ++ MP T +++N +N + S Sbjct: 5 FSNRIKTDIASSTWLSSKFLSRDGSKGSSTASFSYMPRTEGEILQNANLKNFSLSELKSA 64 Query: 428 EQILRPLSLRCP---GTVCLPWKRHCHNSPSRTGTFLSRSTER 547 + RP S+ G V W +PS+ GT + + +R Sbjct: 65 TRNFRPDSVVGEGGFGCVFKGWIDESSLAPSKPGTGIVIAVKR 107 >At5g02290.1 68418.m00152 protein kinase, putative similar to protein kinase APK1A [Arabidopsis thaliana] SWISS-PROT:Q06548 Length = 389 Score = 27.9 bits (59), Expect = 6.9 Identities = 24/103 (23%), Positives = 44/103 (42%), Gaps = 3/103 (2%) Frame = +2 Query: 248 FKTRVTARLSSFALMSASILPKRSLLRLSTTNYWSMPNTRRNLIRNLCTENTTGSFCCPR 427 F R+ ++S +S+ L + ST ++ MP T +++N +N + S Sbjct: 5 FSNRIKTDIASSTWLSSKFLSRDGSKGSSTASFSYMPRTEGEILQNANLKNFSLSELKSA 64 Query: 428 EQILRPLSLRCP---GTVCLPWKRHCHNSPSRTGTFLSRSTER 547 + RP S+ G V W +PS+ GT + + +R Sbjct: 65 TRNFRPDSVVGEGGFGCVFKGWIDESSLAPSKPGTGIVIAVKR 107 >At1g59750.2 68414.m06728 auxin-responsive factor (ARF1) identical to auxin response factor 1 GI:2245378 from [Arabidopsis thaliana] Length = 662 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 301 YTPEEIVVKTVDNKLLVHAKHEEKSDTK 384 YTPEE+ + NKL V+A+ + K+D + Sbjct: 619 YTPEEVKKLSPKNKLAVNARMQLKADAE 646 >At1g59750.1 68414.m06727 auxin-responsive factor (ARF1) identical to auxin response factor 1 GI:2245378 from [Arabidopsis thaliana] Length = 665 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 301 YTPEEIVVKTVDNKLLVHAKHEEKSDTK 384 YTPEE+ + NKL V+A+ + K+D + Sbjct: 622 YTPEEVKKLSPKNKLAVNARMQLKADAE 649 >At3g61415.1 68416.m06878 SKP1 family protein low similarity to SP|P52285 Glycoprotein FP21 precursor {Dictyostelium discoideum}; contains Pfam profile PF01466: Skp1 family, dimerisation domain Length = 351 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 456 RRLNGLRICSLGQQKLPVVFSVH 388 RRLN + S+GQ++ PV FS++ Sbjct: 313 RRLNSSWVLSIGQERQPVNFSIN 335 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,575,724 Number of Sequences: 28952 Number of extensions: 276096 Number of successful extensions: 992 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 992 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -