BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0129 (644 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81547-1|CAB04459.1| 354|Caenorhabditis elegans Hypothetical pr... 28 6.5 >Z81547-1|CAB04459.1| 354|Caenorhabditis elegans Hypothetical protein F53F8.1 protein. Length = 354 Score = 27.9 bits (59), Expect = 6.5 Identities = 19/68 (27%), Positives = 28/68 (41%), Gaps = 5/68 (7%) Frame = +1 Query: 268 KSEIFYSRNDNTDNLTYLHH*HYNEAHNC-----YNS*ILDTYNSFITVSKVSGYHKYHW 432 + E YS + + Y H Y AH+ Y+ YN + V H YH+ Sbjct: 52 RPEEMYSSIVPSSSNGYYHQSQYQNAHHQHHQQHYHQQSHHHYNG-AAAAPVINVHNYHF 110 Query: 433 RTGPIHKQ 456 TGP++ Q Sbjct: 111 HTGPVNNQ 118 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,806,720 Number of Sequences: 27780 Number of extensions: 286531 Number of successful extensions: 829 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 829 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1423653030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -