BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0128 (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05030.1 68416.m00546 sodium proton exchanger, putative (NHX2... 29 3.5 >At3g05030.1 68416.m00546 sodium proton exchanger, putative (NHX2) similar to sodium proton exchanger Nhx1 GB:AAD16946 [Arabidopsis thaliana]; Member of The Monovalent Cation:Proton Antiporter (CPA1) Family, PMID:11500563 Length = 546 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/53 (22%), Positives = 30/53 (56%) Frame = -3 Query: 291 LGTLHSSYLCSIDLIKFHPNLQIFQINLLDFISLFFVYFSNNCICMYFIIIEE 133 +GT+ S + S+ I+F L I +L DF+++ ++ + + +C ++ ++ Sbjct: 118 IGTVVSCTIISLGAIQFFKKLDIGTFDLGDFLAIGAIFAATDSVCTLQVLNQD 170 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,195,753 Number of Sequences: 28952 Number of extensions: 256450 Number of successful extensions: 530 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 530 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -