BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0125 (716 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 2.9 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 23 3.8 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.0 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.0 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.8 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.8 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 8.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 8.8 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 8.8 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 8.8 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 8.8 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +1 Query: 49 KASKLYNNRLNNMSRLIR 102 +A +LY++ L+N +RLIR Sbjct: 20 EAKRLYDDLLSNYNRLIR 37 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.6 bits (46), Expect = 3.8 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 52 ASKLYNNRLNNMSRLIR 102 A +LY++ L+N +RLIR Sbjct: 21 AKRLYDDLLSNYNRLIR 37 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +1 Query: 52 ASKLYNNRLNNMSRLIRIFISLLCVIKTATGL 147 A +LY++ L+N ++L+R ++ V++ L Sbjct: 29 AKRLYDDLLSNYNKLVRPVVNTSDVLRVCIKL 60 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +1 Query: 52 ASKLYNNRLNNMSRLIRIFISLLCVIKTATGL 147 A +LY++ L+N ++L+R ++ V++ L Sbjct: 29 AKRLYDDLLSNYNKLVRPVVNTSDVLRVCIKL 60 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 606 YQRISG*PKDKSLYVMTGTIDEVPKLPP 689 Y ++ P + L +T T+++VP +PP Sbjct: 1090 YNQVGSGPLSEPL--LTQTMEDVPSIPP 1115 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 606 YQRISG*PKDKSLYVMTGTIDEVPKLPP 689 Y ++ P + L +T T+++VP +PP Sbjct: 1086 YNQVGSGPLSEPL--LTQTMEDVPSIPP 1111 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 8.8 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -3 Query: 621 PISFDKFNFNFSSPNIRFFFIIV 553 P+ ++FN+ PN+ F I++ Sbjct: 650 PLDKPLYDFNYEGPNMLFKDILI 672 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 8.8 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -3 Query: 621 PISFDKFNFNFSSPNIRFFFIIV 553 P+ ++FN+ PN+ F I++ Sbjct: 650 PLDKPLYDFNYEGPNMLFKDILI 672 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -2 Query: 445 RRHQILSCLGN*N 407 RRH ILSC G N Sbjct: 179 RRHLILSCQGRLN 191 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -2 Query: 445 RRHQILSCLGN*N 407 RRH ILSC G N Sbjct: 179 RRHLILSCQGRLN 191 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -2 Query: 445 RRHQILSCLGN*N 407 RRH ILSC G N Sbjct: 230 RRHLILSCQGRLN 242 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -2 Query: 445 RRHQILSCLGN*N 407 RRH ILSC G N Sbjct: 179 RRHLILSCQGRLN 191 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 8.8 Identities = 7/22 (31%), Positives = 17/22 (77%) Frame = +1 Query: 52 ASKLYNNRLNNMSRLIRIFISL 117 A +LY++ L+N ++L+R +++ Sbjct: 25 AKRLYDDLLSNYNKLVRPVVNV 46 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,541 Number of Sequences: 438 Number of extensions: 4736 Number of successful extensions: 18 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -