BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0121 (659 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC13B11.03c |||hydroxyacylglutathione hydrolase |Schizosacchar... 27 1.8 SPCC188.11 |prp45|cwf13, snw1, SPCC584.08|transcriptional regula... 26 4.2 >SPCC13B11.03c |||hydroxyacylglutathione hydrolase |Schizosaccharomyces pombe|chr 3|||Manual Length = 256 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +3 Query: 489 KQQHRRVDAHCTLITHHHSFFTMSNLDLR 575 K +++ +D L THHH+ + NL+L+ Sbjct: 48 KLKNKEIDLQAILTTHHHADHSGGNLNLK 76 >SPCC188.11 |prp45|cwf13, snw1, SPCC584.08|transcriptional regulator Prp45|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 26.2 bits (55), Expect = 4.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 642 PRPRCEHISPPRRSSTLRKCRWTLGPSLTS*RNCDG 535 P P H SPPR+ S + W + PS+++ +N G Sbjct: 229 PPPPVLH-SPPRKVSAQEQQDWQIPPSISNWKNPKG 263 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,213,325 Number of Sequences: 5004 Number of extensions: 37876 Number of successful extensions: 102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -