BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0121 (659 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0849 - 25344261-25344416,25344652-25344808,25344917-253450... 29 2.5 01_06_0479 + 29631435-29631608,29632769-29632864,29633065-296331... 29 4.3 04_03_0094 - 11113279-11114469 28 5.7 03_06_0704 + 35641774-35642031,35642122-35642446,35642546-356426... 28 7.6 >06_03_0849 - 25344261-25344416,25344652-25344808,25344917-25345056, 25345160-25345295,25345392-25345663,25345809-25346068, 25346716-25347035,25347287-25347352,25347439-25347510, 25347609-25347680,25347776-25347858,25348068-25348139, 25348389-25348485,25348918-25349050,25349158-25349236 Length = 704 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 542 QFLHDVKLGPKVHRHFLRVELLLGGEMCSHL 634 ++LH+V L P VHR+ +LL E HL Sbjct: 509 EYLHEVCLPPVVHRNLKSANILLDKEYSPHL 539 >01_06_0479 + 29631435-29631608,29632769-29632864,29633065-29633106, 29633220-29633306,29635246-29635272,29635536-29635916 Length = 268 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 466 PRPVASAAPLAPRPPHTDTDSFSR 395 PRP AS P APRP +D + +R Sbjct: 43 PRPAASLRPAAPRPSSSDARARTR 66 >04_03_0094 - 11113279-11114469 Length = 396 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = +3 Query: 504 RVDAHCTLITHHHSFFTMSNLDLRSI---GTFLGSNFFLAARCARISAAVI 647 R+D+ + HH S + LR++ G G NFF A C + A I Sbjct: 231 RLDSFAMICCHHASHVVLQAERLRTLRYKGGLPGENFFSIANCGDVLAMTI 281 >03_06_0704 + 35641774-35642031,35642122-35642446,35642546-35642699, 35643662-35643706,35644121-35644180,35644532-35644694, 35645356-35645717,35645985-35646303 Length = 561 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 469 WPRPVASAAPLAPRPPHTDTDS 404 WPRP AS A A +PP + + + Sbjct: 22 WPRPAASNASSASKPPQSSSSA 43 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,030,691 Number of Sequences: 37544 Number of extensions: 244966 Number of successful extensions: 767 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 766 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -