BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0118 (553 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0) 147 6e-36 SB_49776| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_31082| Best HMM Match : Motilin_ghrelin (HMM E-Value=0.23) 31 0.83 SB_1824| Best HMM Match : Cupin_3 (HMM E-Value=1.6) 29 1.9 SB_55854| Best HMM Match : NinE (HMM E-Value=2.1) 29 1.9 SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) 29 1.9 SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 28 4.4 SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0) 28 4.4 SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0) 28 4.4 SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0) 28 4.4 SB_57310| Best HMM Match : rve (HMM E-Value=2.5e-25) 28 4.4 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_24597| Best HMM Match : RNA_pol_delta (HMM E-Value=0.71) 28 5.8 SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_14940| Best HMM Match : fn2 (HMM E-Value=2.5e-08) 27 7.7 SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0) Length = 768 Score = 147 bits (356), Expect = 6e-36 Identities = 65/90 (72%), Positives = 78/90 (86%) Frame = +1 Query: 31 MTNSKGYRRGTXDLFARRFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGK 210 MTN+KGYRRGT +F+++FR G LSTY+K YKVGDIVD++ NGAVQKGMPHKVYHGK Sbjct: 423 MTNTKGYRRGTRYMFSKKFRHRGVEHLSTYLKCYKVGDIVDVKANGAVQKGMPHKVYHGK 482 Query: 211 TGRVYNVTAHALGVIVNKRVRGRIIPKRIN 300 TGRVYNVT ALGV+VNK+V+G+I+ KRIN Sbjct: 483 TGRVYNVTKRALGVVVNKQVKGKILAKRIN 512 >SB_49776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 31.9 bits (69), Expect = 0.36 Identities = 23/83 (27%), Positives = 35/83 (42%) Frame = +1 Query: 151 DIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSK 330 DI G G+ GMP + G+V ++ A GV++ R ++ + H HSK Sbjct: 102 DIEGTGSYNGGMPQEDLRNTIGQVADL--GAAGVVMWGNRRDENTSPQVCKHINHYIHSK 159 Query: 331 CRQDFLKRVKENERLLKEAKAAG 399 F+ R+K E K G Sbjct: 160 L-GPFIHRMKTTAEKCSELKCRG 181 >SB_31082| Best HMM Match : Motilin_ghrelin (HMM E-Value=0.23) Length = 565 Score = 30.7 bits (66), Expect = 0.83 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 343 FLKRVKENERLLKEAKAAGKTVNLKRQPA-PPKAAHIVSGTEKPVLLAPIP 492 F+KR + +R L+E A +NL ++PA P K + EKPV P P Sbjct: 272 FVKRTQRRQRELEEVADA---INLAKRPAQPEKPLKFLVKVEKPVPRPPTP 319 >SB_1824| Best HMM Match : Cupin_3 (HMM E-Value=1.6) Length = 305 Score = 29.5 bits (63), Expect = 1.9 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +1 Query: 406 VNLKRQPAPPKAAHIVSGTEKPVLLAPIPYE 498 VN + PP A + ++ ++PVL P+P++ Sbjct: 130 VNKSKAETPPPAYYTITSNQEPVLNMPVPWQ 160 >SB_55854| Best HMM Match : NinE (HMM E-Value=2.1) Length = 271 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 289 KRINIRVEH-VKHSKCRQDFLKRVKENERLLKEAKAAGKT 405 +RI ++H ++ K +QDF+ +KE RL +E+++ T Sbjct: 39 ERIQSCIDHKLEERKIKQDFVTLIKERNRLGRESRSGAST 78 >SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) Length = 3369 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 228 RDCSCSRCDCQQACSRKDYTEAHQYPC 308 +D +C CD Q C + T HQ PC Sbjct: 2330 QDPNCGWCDSAQQCMPGNQTRPHQEPC 2356 >SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) Length = 1458 Score = 28.3 bits (60), Expect = 4.4 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = +1 Query: 289 KRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK 468 K I + EH + S C Q F + N + ++ + GKT + + K HI+S +EK Sbjct: 413 KNIELLTEHWECSGCEQRFNRHDNYNRHVTEKRCSGGKTQLICK---GEKFKHIMSSSEK 469 >SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1020 Score = 28.3 bits (60), Expect = 4.4 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 2/100 (2%) Frame = +1 Query: 79 RRFRTHGTIPLSTYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGV 252 R+ T T + + K ++G DI+ R +Q +P K++H ++ H Sbjct: 482 RKKETPETKAMLRHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLVYKELHEEMGHLGAE 541 Query: 253 IVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENER 372 V + R R R+ +EH S CR KR K +R Sbjct: 542 RVLQLARDRFFWPRMQQDIEHYVTSVCRCIKQKRPKHAQR 581 >SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1387 Score = 28.3 bits (60), Expect = 4.4 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 2/100 (2%) Frame = +1 Query: 79 RRFRTHGTIPLSTYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGV 252 R+ T T + + K ++G DI+ R +Q +P K++H ++ H Sbjct: 719 RKKETPETKAMLRHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLVYKELHEEMGHLGAE 778 Query: 253 IVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENER 372 V + R R R+ +EH S CR KR K +R Sbjct: 779 RVLQLARDRFFWPRMQQDIEHYVTSVCRCIKQKRPKHAQR 818 >SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1623 Score = 28.3 bits (60), Expect = 4.4 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 2/100 (2%) Frame = +1 Query: 79 RRFRTHGTIPLSTYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGV 252 R+ T T + + K ++G DI+ R +Q +P K++H ++ H Sbjct: 1270 RKKETPETKAMLRHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLGYKELHEEMGHLGAE 1329 Query: 253 IVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENER 372 V + R R R+ +EH S CR KR K +R Sbjct: 1330 RVLQLARDRFFWPRMQQDIEHYVTSVCRCIKQKRPKHAQR 1369 >SB_57310| Best HMM Match : rve (HMM E-Value=2.5e-25) Length = 440 Score = 28.3 bits (60), Expect = 4.4 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 2/100 (2%) Frame = +1 Query: 79 RRFRTHGTIPLSTYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGV 252 R+ T T + + K ++G DI+ R +Q +P K++H ++ H Sbjct: 166 RKKETPETKAMLRHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLGYKELHEEMGHLGAE 225 Query: 253 IVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENER 372 V + R R R+ +EH S CR KR K +R Sbjct: 226 RVLQLARDRFFWPRMQQDIEHYVTSVCRCIKQKRPKHAQR 265 >SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4529 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/71 (21%), Positives = 35/71 (49%) Frame = +1 Query: 289 KRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK 468 +++ + K R + ++ + +RLL+++++ K L++ P P A + + E Sbjct: 1536 RKLTVEQREPYRLKARDNRVRLKDQEKRLLRQSESEKKHAALEQPPTP--APQVETQPET 1593 Query: 469 PVLLAPIPYEF 501 P+ A P+ F Sbjct: 1594 PIHQAASPFVF 1604 >SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +1 Query: 175 QKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEH 315 ++G PH+ + G TGR A+ + +K + +++ +R NI + H Sbjct: 108 KEGKPHENHSGLTGR-----RGAMRALASKDINAQLLKERFNINMPH 149 >SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1984 Score = 28.3 bits (60), Expect = 4.4 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 2/100 (2%) Frame = +1 Query: 79 RRFRTHGTIPLSTYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGV 252 R+ T T + + K ++G DI+ R +Q +P K++H ++ H Sbjct: 1054 RKKETPETKAMLRHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLVYKELHEEMGHLGAE 1113 Query: 253 IVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENER 372 V + R R R+ +EH S CR KR K +R Sbjct: 1114 RVLQLARDRFFWPRMQQDIEHYVTSVCRCIKQKRPKHAQR 1153 >SB_24597| Best HMM Match : RNA_pol_delta (HMM E-Value=0.71) Length = 1139 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 168 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQ 263 C+S + D+S VQ+DCS R DC + Sbjct: 736 CNSSDIGSTPTILSDKSPVQQDCSSIRRDCSR 767 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/52 (26%), Positives = 21/52 (40%) Frame = +3 Query: 153 HQRQWCSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQACSRKDYTEAHQYPC 308 H + WC++ + W + + C S C ACS+ T A Y C Sbjct: 1804 HNKPWCATTDDFDRDRLWDNMKVDFKPCDASPCRGNGACSQ--VTPAFTYTC 1853 >SB_14940| Best HMM Match : fn2 (HMM E-Value=2.5e-08) Length = 93 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/52 (26%), Positives = 21/52 (40%) Frame = +3 Query: 153 HQRQWCSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQACSRKDYTEAHQYPC 308 H + WC++ + W + + C S C ACS+ T A Y C Sbjct: 30 HNKPWCATTDDFDRDRLWDNMKVDFKPCDASPCRGNGACSQ--VTPAFTYTC 79 >SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 27.5 bits (58), Expect = 7.7 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 311 SMSSTPSADKTSLRESKRMRGY*RKPRLPARPST*RDSQLPLKLP 445 ++S+ PS KT+ ++R RKP +PAR ST ++ P Sbjct: 633 TLSAPPSRPKTAPTSAQRTPEPIRKPLVPARMSTDSTDAFKIQAP 677 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,124,813 Number of Sequences: 59808 Number of extensions: 366364 Number of successful extensions: 1168 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1163 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -